KEGG   Psychromonas ingrahamii: Ping_1955Help
Entry
Ping_1955         CDS       T00450                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00071  Fatty acid degradation
pin00350  Tyrosine metabolism
pin00625  Chloroalkane and chloroalkene degradation
pin00626  Naphthalene degradation
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_1955
  Lipid metabolism
   00071 Fatty acid degradation
    Ping_1955
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ping_1955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ping_1955
   00626 Naphthalene degradation
    Ping_1955
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ping_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N adh_short ELFV_dehydrog Epimerase SIS_2
Motif
Other DBs
NCBI-ProteinID: ABM03724
UniProt: A1SW59
Position
complement(2377614..2378696)
Genome map
AA seq 360 aa AA seqDB search
MSPSSMKASMTAIVTTGSGGYDQLVCKQVPIPDLCNGEVLVKVLAAGVNNTEINTRLGWY
SSSVHGSTNDTSNSEKDQPKADGGWNKQTAFPFIQGTDCCGVVVNVADDVDTGLMDKRVL
IRPCIREHGFGSLDNIWMGSDFDGAFAEYVKIRATEVFPVVCNWSDAELGTIPCAYGTSE
NMLNRANLRAGETVLVAGASGGVGSATVQLAKRRGAKVIAIAGEEKHDKVAPLGADILLG
RSANLLVELGEQSVDVVVDNVGGSGFPTMLKLLKRGGRFVSSGAIAGPIVELDMRDMYLK
DITLIGTTAWEKTVFPDLVRYIEQGEIHPVLAKTFPLSSIAEAQKEFLEKKHVGKFVLIP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctagttcaatgaaagcttcaatgacagccatagtcaccacaggcagtggcggt
tatgaccaattggtctgcaaacaagttccaattccagatctctgcaatggagaagtgctg
gttaaagtgttggccgccggcgttaacaatactgagattaataccagactgggatggtat
tcttcttcagtgcacggctctaccaacgacacctcgaactcagagaaagatcagccaaag
gccgacggcggctggaataagcaaacggcttttccatttattcaaggcacagattgctgt
ggggtggtggtgaatgtggcagacgatgtcgatactggtcttatggacaaacgggtactt
atccggccctgtattcgcgaacacggttttggctctttggataatatctggatgggatct
gattttgatggtgcttttgctgaatatgtgaaaattcgagcaactgaagtgttcccagtg
gtctgtaactggagcgatgcagaacttggtactattccttgtgcctatggtacatccgag
aatatgctcaacagggccaatttgagagccggtgaaacggttttggtagcgggtgcatca
ggtggagtaggctctgctactgtacagcttgcaaagcgcaggggagccaaggttatcgcc
attgcgggagaggaaaagcatgacaaagtagctccgcttggcgcagatattctgttaggc
agaagcgctaatctgcttgtggaattaggggagcaatctgtcgatgttgtggttgataat
gtgggcggaagtggttttccgaccatgctcaaactattaaaacgaggtgggcggtttgtc
tcatccggcgcgattgcagggcctattgttgaacttgatatgcgcgatatgtacctgaaa
gacatcacgctaataggtacaaccgcttgggagaaaactgttttccctgatcttgtgcgc
tacatagagcagggcgaaattcaccccgtgttagcgaagacctttccgttatcttcgatt
gccgaagctcaaaaagagtttcttgagaaaaagcacgtcggtaaatttgtactgataccc
taa

DBGET integrated database retrieval system