KEGG   Psychromonas ingrahamii: Ping_2199Help
Entry
Ping_2199         CDS       T00450                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00051  Fructose and mannose metabolism
pin00562  Inositol phosphate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
pin01230  Biosynthesis of amino acids
Module
pin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pin_M00002  Glycolysis, core module involving three-carbon compounds
pin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2199
   00051 Fructose and mannose metabolism
    Ping_2199
   00562 Inositol phosphate metabolism
    Ping_2199
Enzymes [BR:pin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ping_2199
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ping_2199
  Exosomal proteins of bladder cancer cells
   Ping_2199
  Exosomal proteins of melanoma cells
   Ping_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM03940
UniProt: A1SWS5
Position
2675712..2676464
Genome map
AA seq 250 aa AA seqDB search
MRTPLVMGNWKLNGTKESVSALIKGIEAAADAAKNVEVAVCPPTIFIEQVANLVANNSIE
LGAQDVSTNISGAFTGETSPVMVKEFGAKYSLVGHSERRQYHNETDAVVAAKFVAIQANG
LVPVLCIGETLEERETDKTFNVVETQLKAVIDVSGIDALENAVIAYEPVWAIGTGKVASS
EQAQDVHAHIRTWLAEQSKVVAAKVQILYGGSVKASSAKELFAQPDIDGGLVGGAALLVE
EFVGIIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccactagtaatgggtaactggaaattaaatggcacaaaagaatctgtatcc
gctttaatcaaaggcattgaagccgcagcagatgccgcaaaaaatgttgaagttgccgtt
tgcccgcccactatttttatcgaacaagtagcaaacctagttgcaaataacagcatcgaa
ttaggtgctcaagatgtaagcacaaatatttcaggtgcttttacaggtgagacttctcct
gtaatggttaaagaattcggtgcaaaatacagcttagtcggtcacagtgagcgtcgtcag
taccacaatgaaaccgatgccgttgtagctgcaaaatttgttgcaatccaggcaaatggt
ttagtccctgtattgtgtattggtgaaacgctagaagaacgtgaaactgataaaacattt
aatgttgtagaaacacagcttaaagccgttatcgatgtttcaggtattgacgcattagaa
aacgccgtcattgcatacgagccagtttgggctatcggcacaggcaaagttgcatcttca
gagcaagctcaagatgttcacgcgcacatccgtacttggttagcagagcaaagcaaagtt
gttgctgcaaaagtacaaatcctttacggcggcagtgttaaagcttcaagtgcaaaagaa
ttatttgcccagcctgacattgatggtggtttagtgggtggcgcagcattattggttgaa
gagtttgttggtattatagaaggtgctaaatag

DBGET integrated database retrieval system