KEGG   Psychromonas ingrahamii: Ping_2219Help
Entry
Ping_2219         CDS       T00450                                 

Definition
(GenBank) Ser-tRNA(Thr) hydrolase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00970  Aminoacyl-tRNA biosynthesis
Module
pin_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ping_2219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pin01007]
    Ping_2219
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pin03016]
    Ping_2219
Enzymes [BR:pin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     Ping_2219
Amino acid related enzymes [BR:pin01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Ping_2219
Transfer RNA biogenesis [BR:pin03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Ping_2219
 Prokaryotic Type
    Ping_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon TGS tRNA_SAD DUF4954 CBM_X2
Motif
Other DBs
NCBI-ProteinID: ABM03960
UniProt: A1SWU5
Position
complement(2700524..2702431)
Genome map
AA seq 635 aa AA seqDB search
MPIITLPDGNQRQFDNTTSIMEIAADIGPGLAKACIAGRVDGQLVDACDPIEKDANIAII
TAKDDQGLEILRHSCAHLLGHAIKQLYPNAKMAIGPTIENGFYYDIDLDVTINDDELAKI
AKRMNELVKTNYTVVKEKVSVEEAKALFKERGESYKLEILEGIHPDDRPGLYHHEEYIDM
CRGPHVPVMKFCQYFKLMKVSGAYWRGNSDNKMLQRIYGTAWADKKQLNAYLKRLEEAAK
RDHRKIGKQLDLYHMQEEAPGMVFWHSNGWTIYRELEKYVREQTEAYDYQEVKAPQILDR
ALWEKSGHWGKYKDNMFCTSSENRDYAIKPMNCPGHLQIFNQGLKSYRDLPLRMAEFGSC
HRNEPSGSLHGLMRVRAFTQDDAHIFCTEEQILDEVSACIQMVFECYKTFGFDDIAVKLS
TRPDQRVGDDATWDKAEAALANALTTNNINYGVLPGEGAFYGPKIEFTLYDCLGRGWQCG
TIQLDFSMPGRLDASFVGEDNERHTPVMIHRAILGSLERFIGILTEEYAGVYPTWLSPKQ
VVVMNITDKQSAFVDEVVNKLKKSGIRAISDLRNEKIGFKIREHTLKRVPYLLVIGDQEV
EAGEVAVRTRKGDDLGKFKVDDFAAYIKEEIITRR
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcccattattactctacccgacggtaatcaacgtcaattcgataacactacctcaata
atggaaatcgctgccgatatcggccccggtcttgccaaagcatgtattgccggacgtgtt
gacggtcagttagttgatgcatgtgatcctattgagaaagatgctaatattgccattatt
accgcaaaagatgaccaaggtttagaaattttacgtcactcatgtgcgcatcttttaggg
catgccattaagcagctttatcctaatgctaagatggctattggtccgacgattgaaaat
ggcttttattacgatattgatcttgatgtcacgatcaatgatgatgaattggcaaaaatt
gctaagcgtatgaacgaattagtgaaaactaattatactgtggttaaagaaaaagtttcg
gtagaagaagcaaaagcgcttttcaaagagcgtggtgagagctataaattagagattctt
gaaggtattcaccctgatgatcgtcccgggttataccatcatgaagaatatattgatatg
tgccgaggcccacatgtgccggtaatgaaattctgtcaatattttaaactgatgaaggtc
tcaggcgcatattggcgcggcaattcagataataaaatgttacaacgaatttatggcacc
gcttgggctgacaaaaaacaacttaatgcgtatttaaaacgtcttgaagaagcagccaaa
cgtgaccatcgtaaaattggtaaacagttagacttgtatcatatgcaggaagaagcccca
ggtatggttttttggcatagtaatggctggacaatttatcgagaacttgaaaaatatgtg
cgtgaacaaacggaagcttatgactaccaagaagtaaaagcgccgcaaatactggatcgt
gctctttgggaaaaatcgggacattggggtaaatacaaagacaatatgttctgtaccagc
tctgaaaatcgagactatgcgattaaacccatgaactgccccggacatttacaaatcttc
aatcagggactgaaatcgtatcgcgatttgccactgcgcatggccgagtttggctcttgt
caccgtaacgagccgtccggctcattacacggtttaatgcgtgtacgtgcttttactcag
gatgatgcccatatcttctgcacggaagaacaaattcttgacgaagtatctgcttgtatt
cagatggtatttgaatgttacaaaacctttggttttgatgatattgctgtcaaactatct
acccgcccagatcaacgagtgggcgatgatgcgacttgggataaggccgaagcggctttg
gctaatgcattaaccacaaataatatcaattatggtgtactgccgggtgaaggggctttt
tatgggcctaaaatcgaatttactttatatgattgtttaggtcgtgggtggcaatgtggt
acaattcaactagatttttcaatgccaggtcgtttagacgcttcttttgttggtgaagat
aatgaacgacatacaccggttatgattcaccgagctattttaggttctttagaacgtttt
attggtattctaactgaagagtatgctggcgtttatccgacatggttatcaccaaaacag
gtggtggtgatgaatattaccgataaacagtctgcttttgtcgacgaagttgtaaataaa
ttaaaaaaatcaggcattagagccatttcggacttgagaaatgagaagataggctttaaa
atccgtgagcatacattaaaacgtgttccgtatttacttgtcatcggtgatcaagaagtc
gaagctggtgaagttgctgtaagaactcgtaaaggtgatgatttaggtaaattcaaagta
gacgattttgccgcttatattaaagaagaaatcatcacacgccgttaa

DBGET integrated database retrieval system