KEGG   Psychromonas ingrahamii: Ping_2320Help
Entry
Ping_2320         CDS       T00450                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00260  Glycine, serine and threonine metabolism
pin00680  Methane metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
pin01230  Biosynthesis of amino acids
Module
pin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pin_M00002  Glycolysis, core module involving three-carbon compounds
pin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2320
  Energy metabolism
   00680 Methane metabolism
    Ping_2320
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ping_2320
Enzymes [BR:pin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ping_2320
Membrane trafficking [BR:pin04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ping_2320
Exosome [BR:pin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ping_2320
  Exosomal proteins of melanoma cells
   Ping_2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABM04061
UniProt: A1SX46
Position
complement(2821033..2821839)
Genome map
AA seq 268 aa AA seqDB search
MKIESVQKSGYQKPTLTELQKESTLPVGGEFIALIRHGAYAQLNNTPSAHQPFPLTVEGE
AEVVAQAQKFRLWLIANKLQLAPEVHSSNALRAWQTAQLYIRELSDCFTAIPTHLGFDSL
AERGLGCAANLTVSQIESVLANDPRFDTPPVDWKSNSHYCLPLQGGESLMMAGQRVADHI
ETVMQARKTAILADTADSKNALPQMHLFFGHGASFRHAACHLNVIEFKYISRLSMFYGQP
VILHRDATPWRHVAGNWKERHITAETLD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaatctgtccagaagagtggctatcaaaaaccgacgctaactgagttacaa
aaagagagcactttaccggtgggtggggagtttattgcgcttattcgccatggtgcttat
gcgcagctcaacaatacgcccagtgcgcatcagccatttccattaaccgttgagggtgag
gctgaggttgttgcgcaagcgcaaaagtttcgtctgtggcttattgccaataaactgcag
cttgcgcccgaagtgcattcttccaatgcactgcgcgcctggcaaacagcgcaactctac
attcgtgaattatcggattgttttaccgctataccaacacacttgggatttgatagtctc
gcggaacgtggtttgggttgcgcggcaaatttaaccgtctcgcaaatcgaatcggtactg
gccaatgaccctcggtttgatacgcctccggtggattggaaatccaatagccattactgc
ttaccactgcagggtggtgagtctttgatgatggcgggtcagcgagtcgctgatcatata
gagacggtgatgcaggcgcgtaaaaccgcgattttagccgatacagcagattctaaaaat
gctttgccgcagatgcatctgttttttggtcatggcgcatcatttcgacatgcggcttgt
catctaaatgtaatagagtttaagtatattagcaggcttagtatgttttatggtcaaccc
gttattctgcatcgcgacgccacaccttggcgacacgtcgccggaaattggaaggagcgt
catatcacggctgaaacccttgattag

DBGET integrated database retrieval system