KEGG   Psychromonas ingrahamii: Ping_2738Help
Entry
Ping_2738         CDS       T00450                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00310  Lysine degradation
pin01100  Metabolic pathways
pin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Ping_2738
Enzymes [BR:pin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Ping_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Mqo Pyr_redox_2 Trp_halogenase TrkA_N FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABM04447
UniProt: A1SY82
Position
3358917..3360167
Genome map
AA seq 416 aa AA seqDB search
MKAMYDYVIIGGGIIGVSTAWQLQQRYPEKSILLVEKESQLSRHQTGHNSGVIHAGVYYK
PGSMKAKFCKAGVKATTEFCKKHNIPVENCGKLLVATNQLELERMQDLYQRCHENEIHAI
LLNQAELKIREPNIQGLGAIFVDSTSIVNYTLVTQKMAEEFVKLGGKVMLDTKVINLVES
AENTILTCQSSAEEVSITSRFLVSCSGLMADRITKMLNIETDFQIIPYRGEYHQLPAKHN
NIVNHLIYPIPDPELPFLGVHLTRMIDGSVTVGPNAVQGWKREGYGKININFRDILDMLS
FSGFWKVTKNNLKSGLIETKNSWWKPGYLKMVNKYCDQIKLADLLPYPAGIRAQAVLKDG
SLVHDFLFVESPRSLHVCNAPSPAATSAIPIGNYICDKIMAKQGISKSDELSQKSS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatgtatgattatgtgatcatcggcggtggtattattggcgtatcaacagca
tggcaactgcaacaaagatatcctgaaaaatcgattttattagtagaaaaagaatcacaa
ttatcacgtcatcaaaccggtcataatagtggtgttatccatgcgggtgtttactataaa
ccaggcagtatgaaagcgaagttctgtaaagcgggcgtgaaagcaacgaccgaattttgc
aaaaaacacaatatcccggtggaaaattgtggcaagttactggtcgcaaccaaccagctc
gaattagagcgtatgcaggatctttatcaacgctgtcatgagaacgagattcacgcaata
ctattaaaccaggcagaactaaaaataagagaacccaatattcagggacttggggccatt
tttgtcgactctaccagcatagtaaattacaccctggtcacccaaaaaatggcagaagaa
tttgtgaaacttggcggtaaagtgatgttagataccaaggttatcaatttagtggagtct
gctgaaaacaccattttaacctgccaaagcagcgctgaagaagtgagcattacgagtcgt
tttctcgtctcttgctcaggcctaatggctgaccgaatcactaaaatgctcaatatagag
accgactttcaaattattccttatcgtggcgaataccatcaattgcccgcaaagcacaat
aatattgtcaatcatctgatttatccgattccagatcccgaactcccttttcttggtgtg
catctaactcgaatgattgatggttctgtcactgtgggaccgaatgcggtgcagggctgg
aaacgcgaaggttatggtaaaataaatattaatttccgcgatattctggatatgctcagt
ttctcaggattctggaaagtcaccaagaacaacttaaaatcaggattaattgaaaccaaa
aattcatggtggaaaccaggttatttgaaaatggtcaataaatactgtgaccagattaaa
cttgctgacttactgccttatccagccggaatacgagctcaagcagtattaaaagatgga
agcttagttcatgactttctctttgtagaaagccctcgcagcttgcacgtttgtaatgca
ccctcacccgcagccacatcggcaatcccgatcggcaattatatttgtgacaaaataatg
gcaaaacaaggcatttctaagagtgacgaattatcccagaaatcatcttag

DBGET integrated database retrieval system