KEGG   Psychromonas ingrahamii: Ping_2780Help
Entry
Ping_2780         CDS       T00450                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase E3 component of 3 enzyme complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00020  Citrate cycle (TCA cycle)
pin00620  Pyruvate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Module
pin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_2780
   00020 Citrate cycle (TCA cycle)
    Ping_2780
   00620 Pyruvate metabolism
    Ping_2780
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ping_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABM04487
UniProt: A1SYC2
Position
complement(3420540..3421835)
Genome map
AA seq 431 aa AA seqDB search
MPIEIKLPEVVSGFESGVIASWCVNEGDNIKKGDVIFEVETDKAVIEVESPGAGVLGKIL
VDSNSSPVAVDTIVGMILLENEDPSVLSGEPVITNDDANTPAPVSDVKPDKIQAVPSASS
GASRIMASPLAKVIAANNNIDLSNVVGTGPRNRILKADVENIINNKSDNSPAIMTTSAEN
KPDNSVPLDKVASTVNTENSDITPHTAMRKVIASRLTESKTTIPHFYVSIDCEVDNLNLL
RAEFNAFYKDHENVKLTVNDFIIKAVALAIHKHPEINSMWLSEGVKKNKNIDISVAVSTD
DGLMTPIVFNADRKGLITLSQNMKSLVSKTRSGKLQPNEYQGGGFTISNLGMYDIDSFNA
IINPPQSCILAVGRAKKIPVVKDDQILIANVMNCTLSVDHRVIDGSVAAEFLQTFKFYIE
NPKHMMLFGGE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcctattgaaataaaattgcctgaagtagtcagtggtttcgagagtggagtcattgca
tcttggtgcgttaatgagggagataacattaaaaaaggtgatgttatctttgaagtggaa
acagataaagctgttattgaagttgaaagtccaggggcaggtgttctgggtaaaatattg
gttgatagcaatagctctcctgttgctgttgatactattgttggtatgattttattagaa
aatgaagaccccagtgtactttctggtgaacctgtcattactaatgatgatgctaatacg
cctgcacctgtaagtgatgttaagcctgacaagattcaagcagttccttctgcatcttcg
ggcgctagccgtataatggcaagtccattagccaaggttatagcagcaaataataatata
gacttgagcaatgttgttgggacaggaccacgcaatagaattttaaaagctgacgtcgaa
aatattattaataataaatcagataattcacctgccataatgacaacgagtgcagaaaat
aagcctgataatagtgttcctcttgataaggttgccagtacagtaaatactgaaaatagt
gatattacgcctcatactgcaatgagaaaagtgattgctagccgcctaactgaatctaaa
actacgataccgcatttttatgtgtctattgattgtgaagttgataacttaaacttatta
agagctgagtttaatgctttttacaaagatcacgaaaatgtgaaattgaccgttaatgat
tttattattaaggcggttgcattagctatccataaacaccctgaaattaactcaatgtgg
cttagtgagggtgttaagaaaaataaaaacatcgatatttcagtggctgtttctactgac
gatggccttatgactcccattgtatttaatgcagacagaaaaggtttaattactctttca
caaaatatgaagagtctagtcagtaaaacccgaagtggtaagttacaacccaatgaatat
caagggggaggatttactattagcaacctgggtatgtacgatattgattcttttaatgcc
atcattaaccctccacaatcttgtattttggctgttggtcgtgccaagaaaatacctgtt
gtgaaagatgatcaaattttaattgccaatgtaatgaattgtactttatctgtagatcat
cgtgttatagatggttcagttgctgctgagtttttacaaacatttaaattttatattgaa
aaccctaaacacatgatgctgtttggaggcgaataa

DBGET integrated database retrieval system