KEGG   Psychromonas ingrahamii: Ping_2901Help
Entry
Ping_2901         CDS       T00450                                 

Definition
(GenBank) L-2-haloalkanoic acid dehalogenase, HAD superfamily protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00361  Chlorocyclohexane and chlorobenzene degradation
pin00625  Chloroalkane and chloroalkene degradation
pin01100  Metabolic pathways
pin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ping_2901
   00361 Chlorocyclohexane and chlorobenzene degradation
    Ping_2901
Enzymes [BR:pin01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Ping_2901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ABM04605
UniProt: A1SYP0
Position
3581812..3582489
Genome map
AA seq 225 aa AA seqDB search
MSVILAFDVYGTLINTHGIVTILEKWLGKNAQAFSQTWRDKQLEYSFRRGLMQNYQSFAV
CTRHALDYTCNFYRVSLSKEQKQALMDGYKTLPAFDDAANALAQLKGAGFKLYAFSNGTK
EAVEELLTGAGIRAFFDGIVSCDDLKSFKPNPAVYCHFLRESGAKHNQAWLISSNPFDVI
GAISTGMLSAWVQRSQDAIFDPWDVDPTAIITSLKELKGVLPKPD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgatacttgcttttgatgtctatggaacattaattaatacacatggaatagtg
actattttagaaaaatggttaggtaaaaatgcacaggctttctctcagacttggcgagat
aaacaactggaatactctttccgcaggggattaatgcagaattaccaaagctttgcagtt
tgcacccgtcatgctttggactatacctgtaatttctatcgggtttcactttcaaaagag
cagaagcaagcgttgatggacggttataaaaccctgccagcctttgatgatgcagcaaat
gcgttagcgcaattaaagggtgccggctttaaactttatgccttttctaatggcactaaa
gaagccgttgaagagctgcttaccggtgcaggaataagggcgtttttcgatggaattgtc
agttgcgatgatcttaaatcatttaaacctaatccagctgtctactgccattttttacga
gaatcaggtgctaaacacaaccaggcatggctaatatcaagcaatccctttgatgtaatt
ggcgcaatatcaacagggatgctgtctgcatgggtacagcgttctcaggatgccattttt
gatccctgggatgttgatccaacggcgattattacaagccttaaagagcttaaaggcgtg
ctacccaagccggactaa

DBGET integrated database retrieval system