KEGG   Psychromonas ingrahamii: Ping_3311Help
Entry
Ping_3311         CDS       T00450                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00430  Taurine and hypotaurine metabolism
pin00620  Pyruvate metabolism
pin00640  Propanoate metabolism
pin00680  Methane metabolism
pin01100  Metabolic pathways
pin01120  Microbial metabolism in diverse environments
pin01200  Carbon metabolism
Module
pin_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ping_3311
   00640 Propanoate metabolism
    Ping_3311
  09102 Energy metabolism
   00680 Methane metabolism
    Ping_3311
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Ping_3311
Enzymes [BR:pin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Ping_3311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: ABM04998
UniProt: A1SZT3
Position
4083031..4084245
Genome map
AA seq 404 aa AA seqDB search
MNNKLVLVLNCGSSSLKFAVINADNGGEIMSGLAECFNLPEARIKWKMAGTKKSTSLPPY
SAHSAAISFIVEEIIKKEAGLTEQFVAVGHRIVHGGERFTESVIIDDHVLEGIEQCSSLA
PLHNPAHALGIRAAQVAFPALPQVAVFDTAFHQTMPAKAFMYALPYHLYKEYSIRRYGMH
GTSNLFVTHEAAKILNKPVDDLNVICAHLGNGASVTAIKKGQSVDTSMGLTPLDGLVMGT
RCGDLDPSIIEYLITRLGYSIEGVMEILQKQSGLLGISGISSDFREIIAGYEQGSKRATL
AIDMFIYRLAKYIASYAVPLGHIDAIIFTGGIGENSPLVRSKVLELLTIFGYQVDGEKNK
AAILGNQGIITIAGSPIAMVIPTNEEWVIAQDSAKLVSNQSLSL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaactggtacttgtccttaactgtggcagctcatctcttaaattcgcggtt
atcaatgctgataacggtggtgagataatgagtggtcttgctgaatgttttaatcttccc
gaggcacgtatcaaatggaaaatggcaggaacaaaaaagtccaccagtcttcccccttat
agcgcacactctgcagcaatatcttttattgtagaagagattattaaaaaagaagcaggc
ttaactgagcagtttgtagccgtcggtcaccgcattgttcatggtggcgaaagatttaca
gaatcagttattattgatgaccatgtacttgaaggtattgaacagtgctcatcccttgct
ccactgcataatccggcccatgcgctaggtattcgagcagcgcaggtcgctttcccggcg
cttccacaggttgccgtatttgatactgcattccatcaaactatgcctgctaaagcgttt
atgtatgcactgccctatcatttatacaaagagtacagcatccgccgttacggtatgcac
ggaacaagtaatctgttcgttacccatgaagccgcaaaaatattaaacaaacccgtcgat
gatctcaacgttatctgcgcgcatttaggtaatggtgcatcggtgactgccattaaaaag
ggtcaaagtgtcgataccagtatggggctaacaccgctggatggtttagtaatgggaaca
cgttgtggtgatcttgacccgagtattattgaatacttaataactcgtctgggttacagc
atcgaaggcgtcatggaaatattacaaaaacaaagtggtttgcttggcatttccggtatt
tccagcgatttccgtgaaattattgcaggctatgagcaaggtagcaaaagagcgacactc
gcaatagacatgtttatctaccgccttgccaaatatattgcttcttacgctgtaccatta
ggccatattgatgccattattttcactggcgggatcggtgaaaattccccccttgtccgc
agcaaggtattggaattattaaccatttttggttaccaagtcgacggcgaaaaaaataaa
gccgcgatattgggcaatcaaggtataattacgatagccggctccccgattgcgatggtt
atccctaccaatgaagagtgggtcattgcacaagattctgcaaaactagtttcaaatcaa
tcattatcactataa

DBGET integrated database retrieval system