KEGG   Psychromonas ingrahamii: Ping_3603Help
Entry
Ping_3603         CDS       T00450                                 

Definition
(GenBank) pyruvate dehydrogenase complex, E2 component dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pin  Psychromonas ingrahamii
Pathway
pin00010  Glycolysis / Gluconeogenesis
pin00020  Citrate cycle (TCA cycle)
pin00620  Pyruvate metabolism
pin01100  Metabolic pathways
pin01110  Biosynthesis of secondary metabolites
pin01120  Microbial metabolism in diverse environments
pin01130  Biosynthesis of antibiotics
pin01200  Carbon metabolism
Module
pin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ping_3603
   00020 Citrate cycle (TCA cycle)
    Ping_3603
   00620 Pyruvate metabolism
    Ping_3603
Enzymes [BR:pin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ping_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 QRPTase_N DUF2118
Motif
Other DBs
NCBI-ProteinID: ABM05286
UniProt: A1T0M1
Position
4417560..4418915
Genome map
AA seq 451 aa AA seqDB search
MSNNEHDLKMPSFGSDMKKGTLVQWLVKEGDHIKRGDVVAVIETHKGAIDLDLFEDALII
SLLIKEGQQIAVGEPIARLSSTKDSENAPLPQTDVADIEPNPISTTSPVNISASPASTTT
ATDISSSPASSAVEQDNSNFTTPKDFILATPAARFLATQQQLTLNSLFPEPSNKIVTLTM
VEQAIKQKQLSQQSPAMTENVLKPADKKETAKVKATDRAAARPKKGFDKEAMRQAISATV
TRSKQQIPHYYLRQRLDITALEDYLLQVNAKLAIDQRLLLAAPLLCAVARTLMDSQQLNG
EYTEGHFVASEAIHLANAINLRGGGLVMPVIRAAQTLSPSKMMERLKQQVTHARNDSLVF
SELSGGSFTVTSIGERGAEQMFAVIFPPQVAILALGSPHQEVMAVDGSIKIRSVIEASLA
ADHRVSDGRIGARFLYQLNQLLQNPEALWTV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaacatgacttaaagatgccctcttttggttctgatatgaaaaaagga
accctagtacagtggctggttaaagagggtgaccatataaaacggggtgatgtggttgca
gttattgaaactcacaaaggggcaatagatttagatctatttgaagatgcattaataatc
agcttactgatcaaagaagggcagcagatcgcggttggagagcctattgccagattaagc
tcgactaaagacagtgaaaatgccccccttcctcagacagatgttgccgatatcgagcct
aaccctatatccacaacaagccctgtaaatataagtgcaagccctgcctccacaacaact
gccacagatataagttcaagccctgcgtccagtgcagttgagcaagataacagtaatttc
acaacccctaaagattttattttagcaacacccgcagcgcgatttttggcaacacagcag
caactcactttaaactcactgtttcccgagcctagcaataaaattgttactttgactatg
gtcgagcaagcaataaaacaaaaacagctcagccagcagtcacccgcgatgacagaaaat
gtgctgaagcctgcagataaaaaagaaaccgctaaggtcaaagccaccgatagagcagct
gcaagacctaaaaaaggttttgataaagaagcgatgcgccaagcgattagcgcaaccgtg
acacgctcaaaacaacaaataccacattattatttacgccagcgtttggatataacagcg
ttagaggactacttattgcaggttaacgccaagctcgccatcgatcagcgcctgctctta
gcagcgcctttattgtgtgccgttgcgcgtacattaatggatagccagcaacttaatggc
gaatatacagagggccactttgtcgcgagtgaagcaatacatttagccaatgcgattaat
ttacgtggcggaggattagtaatgccagtcatccgcgcagcacaaactctctccccctcg
aagatgatggaacgtcttaaacagcaggtgacacatgcgcgcaacgacagtttagtcttt
tctgaattgagtggaggcagttttactgtaaccagcattggtgaacgtggtgcagagcag
atgttcgctgttatttttccaccacaggtggcgattctggctttaggtagccctcatcaa
gaggtcatggccgtcgatggttcgataaaaatacgttcagttattgaggcttctctggcg
gccgatcatcgtgtcagtgatggacgcatcggagcccgttttctttatcagttaaaccaa
ctgctgcaaaatccggaagctttatggacagtttga

DBGET integrated database retrieval system