KEGG   Pediococcus inopinatus: PI20285_00280Help
Entry
PI20285_00280     CDS       T05337                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pio  Pediococcus inopinatus
Pathway
pio00450  Selenocompound metabolism
pio00970  Aminoacyl-tRNA biosynthesis
pio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PI20285_00280
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PI20285_00280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pio01007]
    PI20285_00280
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pio03016]
    PI20285_00280
Enzymes [BR:pio01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PI20285_00280
Amino acid related enzymes [BR:pio01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PI20285_00280
Transfer RNA biogenesis [BR:pio03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PI20285_00280
 Prokaryotic type
   Other AARSs
    PI20285_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 NADH-UOR_E
Motif
Other DBs
NCBI-ProteinID: AVK99208
UniProt: A0A0R2II94
Position
58324..60354
Genome map
AA seq 676 aa AA seqDB search
MADKSTYYITTPIYYPSGKLHIGNSYTTIACDAEARFQRLEGKDVFFLTGTDEHGLKIEQ
KAEELGTTPKAYVDGMADGIKKLWKLLDISNTKFIRTTDDYHEKAVQEIFQKLEDSGDIY
LGEYEGWYSVSDEEYFTETQLAEVYHDADGNVTGGKAPSGHEVQKVKEESYFFKMSKYAD
WLLQYYKEHPDFIQPASRMNEMINNFIKPGLEDLAVSRTTFNWGVKVKDNPKHVVYVWID
ALTNYITALGYGSADQSNFDKYWPADVHMVGKEIVRFHTIYWPILLHALGLPLPKHVVGH
GWLLMKDGKMSKSKGNVIYPETLVERYGLDALRYYLLKAMPYGNDGVFTPEDFIDKINYD
LANDLGNLLNRTVAMINKYEDGVIPPFKAGVTEFDEDLEKTAATVVTNYRELMNSLHFSD
ALSEVWKLVSRSNKYIDETAPWVLAKSDDEADRAKLASVMNHLAESLRLLAHLLQPVLTQ
APGKILTQLGLSAQTVNLDELKFGTIPAGTKVIAKGTPIFPRLDAKEEVAFIKAQMTKTD
KKKGRAAMEAAKKAAQTADEPELKSAKKSIRIEAFDKIELKVAEIKSVDHVEGADKLLKF
KLDAGDVGDRQILSGIAEYYPDPSVLVGKKVLIVANLKPRKMRGEISQGMLLSAEHDGHI
QVVEVPKSLVNGSGVE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaatccacatactatataacaactcccatttattatccatcgggaaaatta
cacattggtaattcatatacgaccatcgcttgtgacgcggaggctcgttttcagcgtcta
gaaggtaaagatgttttcttccttacaggaactgatgaacatggcttgaaaattgaacaa
aaggctgaggaacttggcaccacgcctaaggcttatgttgatggcatggctgacggcatc
aaaaagctttggaaattattggatatttcaaacacgaagtttatccgtactacagatgac
tatcatgaaaaagccgttcaagaaatcttccaaaaattggaagatagtggcgatatttat
ttgggcgaatacgaaggttggtactcagtttcagatgaagagtattttacggaaacccaa
ttagccgaagtttatcatgatgcagacggcaatgtgaccggcggaaaagctccatcaggg
catgaagttcaaaaagttaaagaagagtcttactttttcaaaatgagtaagtacgcagat
tggttattgcaatattacaaggaacatcctgattttattcagcctgcaagccgaatgaat
gaaatgatcaataactttatcaagcctggtttggaagatctcgctgtttcacggaccacg
ttcaattggggagttaaagtaaaggataatccgaaacacgtggtttatgtttggattgat
gcgttgacgaactatatcactgctttaggttatggcagcgcggatcaaagtaactttgat
aaatactggccagctgatgtgcatatggtcggtaaagaaattgtgcgtttccatacgatt
tactggccaatcttattacatgcgttaggcttaccactacctaagcacgtagttgggcat
ggctggttattgatgaaagacggcaaaatgtcgaagtcaaagggaaacgtaatttatcca
gaaactttggtagaacgctacggtctagatgctttgcgctactatttattaaaagcaatg
ccttacggaaacgacggtgtgtttacaccggaagactttatcgacaaaattaactatgat
ttggccaatgatttgggaaaccttttgaaccggacagtggcgatgattaataagtatgaa
gacggcgttattccacctttcaaagctggagttaccgaatttgacgaggatcttgaaaaa
acggctgccacagtggttaccaactatcgtgaattaatgaattcgttgcacttctctgac
gctctttctgaagtctggaagttagtgagtcgttctaataagtatattgatgagacagcc
ccatgggttctagctaagagtgacgatgaagctgatcgcgccaaattggctagtgtgatg
aatcatttggctgaaagtttgcgtttattggctcacctgttgcaaccagttttgactcag
gcgcctggcaagattttgacacagttaggtttatctgctcaaacggttaacttagatgaa
cttaagtttggcacaattcctgctggtactaaagtgattgctaaaggaacgccaatcttc
ccccgtttggatgctaaagaggaagttgcctttattaaggctcagatgacaaagactgac
aagaaaaagggtcgtgccgcaatggaagctgctaaaaaagctgcccagactgctgatgaa
cctgaattaaagtcagctaaaaaatcaattcggattgaagcttttgacaaaatcgagttg
aaagttgctgaaatcaagtctgttgatcatgttgaaggtgccgacaaattgcttaaattt
aagttagatgctggggacgttggtgatcgccaaattctttcaggaattgctgaatattac
ccagatccaagtgttttagttggcaaaaaagtgttaattgtcgctaaccttaaaccacgt
aagatgcgtggtgagattagccaaggcatgctgttgtcagcggaacacgatggccatatt
caagtggttgaagtaccaaaatcacttgtgaatggttcgggtgtggaataa

DBGET integrated database retrieval system