KEGG   Pediococcus inopinatus: PI20285_05980Help
Entry
PI20285_05980     CDS       T05337                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pio  Pediococcus inopinatus
Pathway
pio00627  Aminobenzoate degradation
pio01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PI20285_05980
Enzymes [BR:pio01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PI20285_05980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AVL00211
UniProt: A0A0R2IFI6
Position
complement(1178749..1179519)
Genome map
AA seq 256 aa AA seqDB search
MISDYKGYLIDLDGTIYRGRDQIPAAARFVKRLQDTHTDFLFVTNNTTKLPEDVAKNLRD
NHNINVTADEVYTAGLATADYLDGIAGDKRKVYVIGELGLKQALLNKKFTFDEVHPDWVV
VGLDYDVTYHKFELATLAIKRGATFIGTNADTNLPNERGLVPGAGSLIGMVERATQQRAT
YVGKPETIIMQKAVRQIGLAKEDVVMVGDNYMTDISAGINFGIDTLLVYTGVSTREFVKK
QEVQPTHEIQSFDEWK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagattataaaggatatttaattgatttagatggaacaatttatcgtggtcgt
gaccaaattccggcagcagctagatttgtcaaacgattacaagatacacatactgatttt
ttgtttgtgacgaacaatacaaccaagttaccagaagatgtagccaaaaacctgcgggat
aatcataatattaatgtcacggccgatgaagtctatacagctggactggcaaccgctgat
tatttagacgggatagctggcgacaagcgtaaagtttatgtcattggtgaactagggtta
aagcaagcacttttgaacaaaaaatttacatttgatgaggttcatccagactgggtggtt
gttggattggactatgatgttacttatcataaatttgaattagcaactttggctataaaa
cgaggtgcgacattcattggaacaaatgcagatacaaatttgcctaatgagcgaggatta
gttccaggagcgggttctttaattggaatggtagaacgagctacccaacaaagagccacg
tatgttggtaaaccagagacgatcatcatgcaaaaggcagttagacaaattggtttagcc
aaggaagatgtggttatggttggggataattacatgactgatatttcggctggaattaat
tttggtattgacacgttacttgtgtataccggcgtttcaacccgtgaatttgtaaagaag
caagaagttcaaccgactcatgaaattcagtcgtttgatgaatggaagtaa

DBGET integrated database retrieval system