KEGG   Pediococcus inopinatus: PI20285_06110Help
Entry
PI20285_06110     CDS       T05337                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pio  Pediococcus inopinatus
Pathway
pio00471  D-Glutamine and D-glutamate metabolism
pio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PI20285_06110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pio01011]
    PI20285_06110
Enzymes [BR:pio01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     PI20285_06110
Peptidoglycan biosynthesis and degradation proteins [BR:pio01011]
 Precursor biosynthesis
  Racemase
   PI20285_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF3865
Motif
Other DBs
NCBI-ProteinID: AVL01085
Position
complement(1201571..1202395)
Genome map
AA seq 274 aa AA seqDB search
MDNRAIGFMDSGVGGLTVVREALRQLPLESVYFIGDQARLPYGPRSSDEVRHFSEQMASF
LMQRDIKMLVIACNTATAAALEDLQEKLPIPVIGVISPGSRAALKATRNRRIGVIGTEGT
IKSQAYERAILSKDNSVEVFSLACPKFVPLVESNEYDSPIAKKVVAETLQFFENKDVDTL
ILGCTHYPLLRPIIQDVMGEQVKLIDSGAETVGTVSALLDYFEIAKDAAGDQTKNAYFTT
ASPLSFNQIASQWLEIDIQSKKAQIDELELRIEK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggataaccgtgcaattggatttatggattcaggagtaggtggtttgacggtcgtgcga
gaggctttacggcaattaccgcttgaatctgtttactttattggggaccaagctagattg
ccttatgggcctcgttctagtgatgaggttcgtcatttctctgaacaaatggcctctttt
ttaatgcagcgggatattaaaatgttagtcattgcttgcaatactgcaacagcggctgcg
ttagaagatctccaagaaaagctgccgattccagtaattggggtgatttctccaggaagc
agagccgcattaaaagccactcgtaatcgtcgaattggcgttattggaacggaaggcaca
attaagagtcaggcctatgaaagggcaattctgtctaaagacaattctgttgaggtcttt
agtttagcgtgtcccaagtttgtgcccctcgttgagagcaatgagtatgattcaccaatt
gctaaaaaggtcgttgccgagacgttacagtttttcgagaataaagatgtggatacattg
attttgggatgtacacactatccgcttttaagaccaattatacaagatgtgatgggtgaa
caagttaagctaatcgattcgggtgctgaaactgtgggaaccgtttctgcgttgttggat
tattttgagattgccaaagatgcagcaggtgatcaaactaagaatgcatactttacaaca
gcttcccccttaagctttaatcagattgctagccaatggttagagattgatattcaatca
aaaaaagcgcaaattgatgaactagaattgaggatagaaaaatga

DBGET integrated database retrieval system