KEGG   Pediococcus inopinatus: PI20285_10265Help
Entry
PI20285_10265     CDS       T05337                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pio  Pediococcus inopinatus
Pathway
pio00480  Glutathione metabolism
pio00590  Arachidonic acid metabolism
pio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PI20285_10265
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PI20285_10265
Enzymes [BR:pio01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PI20285_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Pox_P4B
Motif
Other DBs
NCBI-ProteinID: AVL00994
UniProt: A0A0R2I5E3
Position
complement(2080734..2081219)
Genome map
AA seq 161 aa AA seqDB search
MSIYDYTVTLENGDTYSLEKYRDHPLVIVNTATKCGFAPQFKQLEQLYKEYKDQGLVVLG
FPSNQFKQEVSTSEEAAAACRTTYGVSFPMHTIADVNGKDALPLFKYLTEAAPGTLGSAI
KWNFTKFLVDREGNVVKRYAPKTNPLKMTDEIEKPLKSTTK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattataccgttacattagagaatggtgatacttattcactagaaaaa
tatcgtgaccacccgttagttattgtgaacactgctactaaatgtggatttgcgcctcag
tttaagcagttagaacaactttataaggaatataaggatcaggggctggttgtattggga
tttccatccaatcaattcaagcaagaagtatccactagtgaagaagcggctgctgcctgt
cggaccacctatggcgtgagctttcccatgcacacgattgcagatgtaaacggcaaagac
gcactacctttgtttaaatatttaactgaagccgcacccggtacattgggttctgctatc
aaatggaatttcacaaaatttctcgttgatcgtgaaggaaatgtcgtaaaacggtatgcc
ccgaagactaaccctttaaaaatgactgacgaaattgaaaaaccactaaaaagcaccaca
aaatag

DBGET integrated database retrieval system