KEGG   Pediococcus inopinatus: PI20285_10915Help
Entry
PI20285_10915     CDS       T05337                                 

Definition
(GenBank) noncanonical pyrimidine nucleotidase, YjjG family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pio  Pediococcus inopinatus
Pathway
pio00625  Chloroalkane and chloroalkene degradation
pio01100  Metabolic pathways
pio01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pio00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PI20285_10915
   00361 Chlorocyclohexane and chlorobenzene degradation
    PI20285_10915
Enzymes [BR:pio01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PI20285_10915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: AVL01183
Position
pLDW-12:complement(71560..72240)
Genome map
AA seq 226 aa AA seqDB search
MNYPTLLFDVDDTLLNFQASEHQAIQKLFNQINRPLTSKAYQNYHQMNEGLWRRLERGEI
SRETLLNTRFQIFFSQYGLDVDGVAYEKQYRQFLSAGHDPIPNAVQLLNDLSHHHQLYIV
TNGIAATQKRRLRESGMAKYITKMFVSETVGHPKPEPQFFDYVAESIDHFDKQQSLVVGD
SLTSDILGAANYGLDSVWFNPAHQQNSTSTKPTYEIAELMELENIV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaactatccgacccttttattcgatgttgacgataccctgcttaactttcaggcatca
gaacatcaggccattcaaaaactgtttaaccaaatcaatcgaccactaacttccaaagcc
tatcaaaactatcatcaaatgaacgaagggctttggcgccgtttagagcgtggcgagatt
tcacgagagacattactgaatacccgattccaaatattcttcagccaatacggtttggat
gttgatggcgtggcctatgagaaacaatatcgccaatttttatcggcaggtcatgatcca
atcccaaacgctgtccaattgctaaacgatttgagtcatcaccatcaactctatattgta
accaacggaatcgcagcgactcaaaaacgccgacttcgtgaatctggaatggcaaaatat
atcacaaaaatgtttgtctcagaaacagttggccatcctaaacccgaacctcaattcttt
gactacgtagctgaaagtattgatcattttgataagcagcaatcattagttgtcggtgat
tcattaacctcagacattcttggtgccgccaattatggccttgattcagtgtggttcaat
ccagctcatcagcaaaattcgacttcaacaaaacctacttatgaaattgctgaattaatg
gaattagaaaatatcgtctaa

DBGET integrated database retrieval system