KEGG   Pirellula sp. SH-Sr6A: VN12_08675Help
Entry
VN12_08675        CDS       T04360                                 

Gene name
yjmD
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YjmD
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pir  Pirellula sp. SH-Sr6A
Pathway
pir00030  Pentose phosphate pathway
pir01100  Metabolic pathways
pir01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VN12_08675 (yjmD)
Enzymes [BR:pir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     VN12_08675 (yjmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N Shikimate_DH NAD_binding_3 AlaDh_PNT_C ApbA ThiG
Motif
Other DBs
NCBI-ProteinID: AMV32184
UniProt: A0A142XZA5
Position
complement(2072687..2073790)
Genome map
AA seq 367 aa AA seqDB search
MKAIAVRPGTPSSVHERDIPAPSLDRIPDGKGILVKVLKVGVDATDREINDALYGNAPPG
DDYLVLGHESFGIVEAVGPNVRSVKPGDYVTATVRRPGGSIYDKIGTYDMTSEETYYERG
INLLHGYLTERFVDHEDYIVRVPQGLKHLHVLMEPMSCAAKAIQQAYEAQRRMKVWSPKR
AFVLGAGQIGLLSTLVLRLKGLEVYTLARAKGPHLKSSIVEGLEATYVATSETSLEQLAK
KVGKADLIIDATGSSSIAFNAMEALGHNGVLVWTSITGGKHVTEISSDKINLEWVLGNKL
LVGSVNANREHFESGIKDLAMSEVMFPGVIGKILTNPVEGLSNYKEMMRLLVEDNSALKV
YVNVADE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcgctgtccgtcccggtactcctagcagtgttcatgaacgcgatatcccg
gctccttcgctggacaggattccggacggcaaaggcatcttggtcaaagtgctcaaagtg
ggggtcgacgcgaccgaccgtgaaatcaatgatgctctgtatggaaacgcgcctcccgga
gacgattaccttgttctgggacacgaatcgtttgggatcgtcgaagcggtcggacccaat
gttcgttccgtaaagcctggggattacgtaaccgccacggtgcgacgccccggtggttcg
atctacgataagatcggtacctatgacatgacgagcgaagagacctactacgagcgcggc
atcaatctgttgcatggttatctgaccgagcgttttgtggatcatgaggattacatcgtt
cgcgtcccacaaggattgaagcacttgcatgtcttgatggagccgatgagctgtgcggcg
aaggcgattcagcaagcctacgaggcacagcgtcgcatgaaggtttggagtcccaagcga
gcgtttgtgctcggagctggccaaatcggattgctttccacgcttgtattgcgattgaag
ggtctggaggtttataccttggcccgcgcgaaaggccctcacttgaagagctccatcgtc
gagggcttggaagcaacctacgtggcgacatccgagacgagtttggaacagctggcaaaa
aaggttggaaaagcggatctgattatcgacgcgacaggttcctcgtcgatcgccttcaat
gcgatggaagccttgggccacaatggtgttttagtctggaccagtatcacgggtgggaag
cacgtgacggagatctcgtccgacaaaatcaacttggaatgggtgctcggtaacaagctt
ctcgttggttccgtgaacgcaaaccgcgagcactttgaatcgggtatcaaagatttggcg
atgtccgaggtgatgttccccggcgttatcggaaagatcttgacgaatccagtcgaaggt
ttgagcaattacaaagaaatgatgcgtctcctcgtggaagacaacagcgcgctcaaagtc
tatgtcaacgtagcagacgaataa

DBGET integrated database retrieval system