KEGG   Pirellula sp. SH-Sr6A: VN12_11780Help
Entry
VN12_11780        CDS       T04360                                 

Definition
(GenBank) Putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pir  Pirellula sp. SH-Sr6A
Pathway
pir00790  Folate biosynthesis
pir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VN12_11780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pir04147]
    VN12_11780
Enzymes [BR:pir01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     VN12_11780
Exosome [BR:pir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VN12_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AMV32796
UniProt: A0A142Y0Q6
Position
complement(2847532..2847915)
Genome map
AA seq 127 aa AA seqDB search
MTQVATTDELIQRKCAACEGGLPPCSPELAREQLAHLGDWKLDESGKSIRRGLRFRNFLQ
AIDALNRIAELAEQEQHHPDLHLTSYRVLTIVLTTHAVSGLSENDFILAAKIDRLIGTSF
ADAKPNP
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagttgccacgacagatgaacttatccaacgaaaatgcgctgcctgcgaagga
gggctccctccctgctcccccgagttggcacgcgagcaactcgctcacttgggcgactgg
aaactcgacgagtcgggaaagtctattcgccgcggtctccgttttcggaatttcctgcag
gcgatcgacgctctcaatcgaattgctgagctggcggaacaagagcaacatcacccggac
ctccatctcactagctaccgcgtcttgaccatcgtattgaccacccacgccgtctccggc
ctcagcgaaaacgacttcatcttggccgcaaaaattgaccgcttgatcggaacatccttt
gccgacgccaagccaaacccatga

DBGET integrated database retrieval system