KEGG   Pyrobaculum islandicum: Pisl_0104Help
Entry
Pisl_0104         CDS       T00444                                 

Definition
(GenBank) methenyltetrahydrofolate cyclohydrolase / 5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00670  One carbon pool by folate
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01120  Microbial metabolism in diverse environments
pis01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pis00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0104
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Pisl_0104
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Pisl_0104
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Pisl_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: ABL87287
UniProt: A1RQQ5
Position
99095..100030
Genome map
AA seq 311 aa AA seqDB search
MVVWIKGDRLHTETLEWARRHVKELERYGVTPKLAVLLLNDDPIELETQHKYVSLKARDI
KSIGGEVELFELYKEPPEKREVAALKLIERLNNADDVTGILVQKPLPPYVDETKIFERLS
PLKDVDGLTPENKKRLVTGFDLDRDILPCTPAGILELFRQYKIDVRGKDVVVVGKGTLVG
FPLSIMLMQLDATVTVLHALSKDRKYYVRNADIIISAVGRPPELYSDNPWKLTGDFIKEG
AVVVGVGGKVDPVTKKWYFDVDEKSVAEKASYLTPNIGGVGLATRARLVKNLIITSYMVA
TRVASPRLLAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttggattaaaggcgacagactacatacagaaactctggagtgggctagacgc
cacgtgaaggagttagagcgctatggagttactccaaagctagccgtactccttctaaac
gacgacccaatagagttggagacgcaacataaatacgtatctctaaaggcaagagatatt
aagtctataggaggtgaggttgagcttttcgagctatataaagagccgccggagaaaaga
gaagtcgcggcgttgaaattaatagagaggttgaataacgcagatgatgtaactggcata
ttagtccaaaagcctctgccgccgtatgtagacgagacaaagatttttgagagactctcc
cctctaaaagacgtagatggccttacccccgaaaataaaaaacggctagtgacaggcttc
gacttagatagagatatcttgccttgtacacccgccggtatactggagttatttagacaa
tataaaatcgacgtcagaggcaaggatgtcgttgtagttggcaaggggactttggtgggg
tttccactctctataatgttaatgcaactagatgcaacagtcacagttctccacgccctg
agtaaagacagaaaatattacgtaagaaacgcagatattataatttccgcagtggggagg
ccgccggagctatacagcgacaacccctggaagctcactggagattttataaaagagggc
gccgtagtagtcggcgtaggcggcaaggttgacccagttacaaaaaagtggtatttcgac
gttgatgaaaaaagcgtagctgagaaagcgtcttatctaacgccaaatatcggcggcgtg
ggacttgccactagagcccgccttgtgaaaaacctcataattacgagttatatggttgca
acacgcgtcgcctcgcctagacttctcgctctttaa

DBGET integrated database retrieval system