KEGG   Pyrobaculum islandicum: Pisl_0119Help
Entry
Pisl_0119         CDS       T00444                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00860  Porphyrin and chlorophyll metabolism
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
Module
pis_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pisl_0119
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Pisl_0119
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Pisl_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 AlaDh_PNT_C 2-Hacid_dh_C IlvN ApbA Rossmann-like Shikimate_DH Pyr_redox_2 TrkA_N Pyr_redox NAD_Gly3P_dh_N F420_oxidored CysG_dimeriser FAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABL87302
UniProt: A1RQS0
Position
112044..112895
Genome map
AA seq 283 aa AA seqDB search
MNHTSSPGGGRALRLSQPAPRSSTMRLRAQAPWRLGHHKGVTYFIKLGDVCKGAQRYKNK
VDVRDVRIPLWVEASRLKVLILGGGSVGTRRAKYFHTAGAKVRVIARDVTPELKSMGVEI
KYADLNVYEPAEDIKWADIVVIAVDDQRLAEKLFRQAEALGKLINDATDATRTHVVVPYE
REIAGLRVAVTSEGAAGTPARLSLDIIEGCIKESWIPVFYSVYRELKNEAKTLIKNTKTR
LHFYQKLVEDEKFMKYVKEKDEKAAIKRGRELLHSILNEEKAA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacacctccagccctgggggtggccgggccttgcggctatcccaaccagccccg
cggtcgtctactatgcggttgcgggcccaagccccctggagactcgggcaccacaaaggg
gttacttattttataaagcttggcgacgtatgtaaaggcgcccaaagatataaaaacaaa
gtagatgtgagggatgtgcgtatacctctctgggtcgaggcttcacgtctaaaagttcta
atacttggcggaggctctgtggggacgcgtagagctaaatattttcacacggcgggcgcc
aaggtgagagttattgcaagagacgtcacgccggagttaaaatccatgggagtagagata
aaatatgcggatctcaacgtctacgaacccgccgaggatataaaatgggcagacatagtg
gtaatcgcagttgatgatcaaagacttgcagagaaactctttagacaggctgaggcgttg
ggcaaattgataaacgacgccacagatgccacacgtacacacgtggtagtgccctacgag
agagaaatcgcaggactaagagtagcagtcactagcgaaggcgcggcgggcacgccggct
agactttcactagacataatagagggctgtattaaagaaagctggattccagtattctat
agtgtatatagagagctaaagaacgaggcaaaaacattgataaaaaacacaaaaacaaga
ctacacttctaccaaaagttagttgaagatgaaaaatttatgaaatatgtaaaagaaaaa
gacgaaaaagctgcaattaaacggggaagagaactgctacactctatcctaaatgaggaa
aaggccgcctag

DBGET integrated database retrieval system