KEGG   Pyrobaculum islandicum: Pisl_0324Help
Entry
Pisl_0324         CDS       T00444                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit / pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis00020  Citrate cycle (TCA cycle)
pis00620  Pyruvate metabolism
pis00633  Nitrotoluene degradation
pis00640  Propanoate metabolism
pis00650  Butanoate metabolism
pis00680  Methane metabolism
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
Module
pis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pis_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0324
   00020 Citrate cycle (TCA cycle)
    Pisl_0324
   00620 Pyruvate metabolism
    Pisl_0324
   00640 Propanoate metabolism
    Pisl_0324
   00650 Butanoate metabolism
    Pisl_0324
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0324
   00680 Methane metabolism
    Pisl_0324
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_0324
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_16 Fer4_10 Fer4_9 Fer4_2 Fer4_8 Fer4_17 Fer4_13 Fer4_15 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ABL87502
UniProt: A1RRC0
Position
323443..324381
Genome map
AA seq 312 aa AA seqDB search
MRIETLWLGRGGQGIVTATYIIANAAVMDGFYAIANPEFGAERRGAPVKAFLTIDKNPIE
DLEPIKTPDAVIIFDDKLIDSMRFAIDAVKPGGYVIVNSAKQPEEVRKIVGRNDVYIVVV
DAVGIAMKHVGLPVPNGPLAGAFSKVMGFPRLESIKTAFENQLGKAVEENFAATKEAYEV
AVVLKPEKVDTSAKPKGVISTTSAFLTGPYELVGWQQVNKGGAVGPGSSLQYLTGGWRIE
KPIIDHSKCIMCRKCWLYCPDDAIIEAWREAPGPRGRVFRTKVIDFDYQYCKGCGICAEV
CPTGAIQMVREI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatagaaactctctggcttggccgtgggggtcagggaatcgtcactgctacatac
atcatcgcaaatgccgctgttatggacggattctacgccattgcaaacccagagtttggc
gcagagagaagaggcgcgcctgtcaaggccttcctcactatagacaaaaaccccattgag
gatttagagcccatcaagacgccggatgccgtcattatatttgacgataaacttatcgac
tccatgagatttgctatagatgctgtaaagcccggtggctatgtcattgtaaacagcgct
aagcaacccgaggaggtgcggaagattgtagggagaaacgacgtctatatcgtagtggtg
gacgcagtcggcatcgccatgaaacacgtgggtctccccgttccaaacggtccgctggct
ggcgccttctccaaggtgatgggcttccccaggcttgagtcgataaaaaccgcgtttgag
aaccagctgggcaaggccgtggaggagaacttcgccgccacgaaggaggcctacgaggtg
gccgttgtcctcaagcccgagaaggtggacacctccgcgaagccgaaaggggtaatatcc
accacatcggccttcttgaccgggccctacgagctggtgggttggcaacaggtgaacaag
ggcggcgccgtcggtcctggcagcagcttgcagtatctcacgggcggctggaggatagag
aagcctattatagaccactccaagtgtataatgtgcagaaagtgctggctgtattgtcca
gacgacgccataatagaggcttggagggaggcgccggggccgagaggccgcgtctttagg
actaaggtcatcgacttcgactaccagtactgcaagggctgtgggatctgcgcagaggtc
tgtccaacaggggcaatacagatggtgagagagatatga

DBGET integrated database retrieval system