KEGG   Pyrobaculum islandicum: Pisl_0928Help
Entry
Pisl_0928         CDS       T00444                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00051  Fructose and mannose metabolism
pis00520  Amino sugar and nucleotide sugar metabolism
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pisl_0928
   00520 Amino sugar and nucleotide sugar metabolism
    Pisl_0928
Enzymes [BR:pis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Pisl_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954 Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABL88104
UniProt: A1RT22
Position
825660..826739
Genome map
AA seq 359 aa AA seqDB search
MAESGIILAGGFATRLRPLSYTKPKPLFPVLGRPVLDWVIEKVAEVTEPVISARYLSNII
KNYVAARWGDRVRVIEEDKPLGDGGAVINVVKSLGLRGPIIVANGDVFTDLSVKSLWEYH
KRSGAAVTIALIEVPPDEISRFGIAVLDERGHIKRFVEKPREPIGSNLANAGFYIFEPEA
VKEFPESNSGEVKIAKHIIPRLMEKFDIYGYIHRGLWFDIGTYNDYLKANFAALDNCKFC
SPEVPGVKIIPPVYMGEGVVIGPGSVIGPYAVIGARSKLGPYVRVKESVLMEGVVAEAGA
YIYRSIVGEGVVLGKWVRLIEAVVADGVYVKDEVYVGRGAAVGPNREVEQDVKDGEILP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagagtggcattattttagccggtggttttgccactagattgagaccgctcagt
tatacaaagcctaaaccgcttttccccgtcctggggaggcccgtgcttgactgggtaatt
gagaaagttgccgaagttacagagcctgtgatatctgcaagatatctgtctaacataatc
aaaaactacgtggccgccagatggggagatagagtgagagttatagaggaggataagccg
ttgggcgatggcggtgctgttataaatgtagttaaaagtctcggcttaagaggccctatt
attgtggctaatggcgatgtttttacagacctctctgtaaaaagcctatgggaatatcat
aagaggtctggcgccgcggtgactatagcactaattgaggtacctcccgatgaaataagc
agatttggcatagcggtattagatgagagaggccacatcaagagatttgtagagaagccc
agagagcctattggaagcaacttagctaatgccggcttttacatcttcgagcccgaggca
gtgaaagaatttcccgagtcaaactccggagaggtgaaaatagccaaacacataattcca
cgcctcatggaaaaattcgacatatatggttatatacaccgggggttgtggtttgacatt
ggaacttacaacgactatctaaaggctaatttcgcagcgcttgacaattgtaaattctgt
agtccagaggtgcccggtgtgaaaattataccgcctgtctatatgggagaaggcgttgta
atagggcctggaagcgtgatagggccttacgcagttattggagccaggagtaagttaggg
ccctatgtccgtgttaaggaaagtgttctaatggagggggttgtggccgaagcgggggcg
tatatctaccgctctattgtaggtgaaggcgttgttttaggcaagtgggtgcgcttaata
gaggctgtagtagcggacggcgtttatgtcaaagacgaagtatatgtaggccggggcgct
gcggtggggccgaatagagaggtagaacaggatgtaaaagatggagagattttaccctag

DBGET integrated database retrieval system