KEGG   Pyrobaculum islandicum: Pisl_1233Help
Entry
Pisl_1233         CDS       T00444                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis00020  Citrate cycle (TCA cycle)
pis00620  Pyruvate metabolism
pis00633  Nitrotoluene degradation
pis00640  Propanoate metabolism
pis00650  Butanoate metabolism
pis00680  Methane metabolism
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
Module
pis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pis_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1233
   00020 Citrate cycle (TCA cycle)
    Pisl_1233
   00620 Pyruvate metabolism
    Pisl_1233
   00640 Propanoate metabolism
    Pisl_1233
   00650 Butanoate metabolism
    Pisl_1233
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_1233
   00680 Methane metabolism
    Pisl_1233
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_1233
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C bZIP_1
Motif
Other DBs
NCBI-ProteinID: ABL88398
UniProt: A1RTW6
Position
1116399..1117343
Genome map
AA seq 314 aa AA seqDB search
MKLYYRTLRDLPREELFAPGHRMCAGCGAAIAMRWITKTVGPNAIIVNATGCVEVTTTPY
PETAWMHPYIHVAFENSAAVASGVEAAIKTLKRKGMWDAGDTKVVVIAGDGGTYDIGLQS
LSGMLERRHGVLYILYDNEAYMNTGIQRSGSTPKFAWTTTTPVGTAIRGKIQWKKDIMGI
VMAHRVPYAATASVAYVLDMVNKIKTALEYTAEGPTFLHIFTPCVPGWRYPENKTVEVAR
LAVETGYFPLYEWDHGKLILNPPSNNHIDKSRRKPLKEYLKLQGRFAHLTEEEITELEKE
LDAYWQYLAKLAQL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactataggactctaagagatttaccacgtgaggagctctttgcccctggc
cataggatgtgcgccggttgtggcgccgcaattgccatgaggtggataacaaaaacggta
ggtcctaacgcaataatagtcaatgcgaccggctgtgttgaagttacaacaacgccgtat
ccagaaacggcgtggatgcacccctatatacacgtggcgtttgaaaactctgcagcagtg
gcatccggcgtggaggccgcgataaaaactctcaagagaaagggtatgtgggatgcgggg
gatacaaaagtagttgtgattgcaggagacggcgggacatacgatataggtttacagtcg
ctcagtgggatgcttgaacggagacacggcgttttgtacatactctacgacaacgaggcc
tacatgaacacaggcatacaaagaagcggttccacgccaaaatttgcctggacaacaaca
acgcctgtgggtactgcaattagagggaaaatacaatggaaaaaagacatcatgggcata
gtaatggcccacagagtgccttatgctgcaacagcaagtgtagcgtatgtattagatatg
gtaaataagataaagacggcgcttgaatataccgcggagggtcccacattcctacatatc
tttaccccctgtgtccccggttggcgctatccagaaaataagacagttgaagttgctaga
ctagcggtagagaccggctattttccactttacgaatgggaccatggcaagttgatacta
aatccgccgagtaacaatcacatagacaaatcgagaagaaagccgttaaaagaatattta
aaacttcaggggagatttgctcacctcaccgaagaggaaataacagagctagaaaaagaa
cttgatgcctattggcaatatctcgcaaaattagctcaattatag

DBGET integrated database retrieval system