KEGG   Prevotella intermedia: PIN17_0490
Entry
PIN17_0490        CDS       T02058                                 

Definition
(GenBank) phage-like baseplate assembly protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pit  Prevotella intermedia
Pathway
pit03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pit00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PIN17_0490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pit02044]
    PIN17_0490
Secretion system [BR:pit02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PIN17_0490
SSDB
Motif
Pfam: Phage_base_V Phage_GPD
Other DBs
NCBI-ProteinID: AFJ07797
Position
I:complement(523948..525057)
AA seq 369 aa
MYGRPARQHALPRIHTESELIKYMRRKQAADTAETHYVTAESHVPELRVGSVVRLYSSFL
ERVGQLTRESLGDFIITEIVHEVGDGSYYRNRFKAIPSTVEALPSPRVPMPVAETQMATV
TSNADPNGNGRVQVRMNWQQGGMHTGWVRVMTPDAGKSGDVSSNRGFVFIPEVGDQVLLG
FRHGDPGRPYVMGSLFNGSTGGGGGQGNKCKSLTTRSGSSLKLDDSDGSVTLHDKGGVSM
NFDGAGNSTFNSNTSHTVNAGSNASTNVGEGASVLNMDSGGCVELTSQSEVSIKVGSASI
SMNNSSITLSIGSSSITLTSENILSKGTTLSMESTTSTSISGGQNIDISATQNHIGGETK
MDGGDVFVN
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtacggcaggcctgcgcgccagcacgcgcttccccgcatccacacggagtccgaactc
attaaatacatgcgccgcaagcaggcggccgataccgccgagacccactacgtcactgcc
gagagccatgtgcccgagctccgtgtgggttccgtcgtccgcctctacagctccttcctg
gagcgtgtcggtcagctgaccagggagagcttaggcgacttcatcatcaccgagatcgtc
cacgaggtgggtgatggcagctactaccgcaaccgcttcaaggccattccctctaccgtt
gaggcccttccgagcccccgtgtcccgatgcccgtggctgagacgcagatggcgactgtc
accagcaatgccgacccgaatggcaacggccgcgtccaggttcgcatgaactggcagcag
ggcggcatgcacacaggctgggtacgcgtgatgacgcccgacgcgggcaagagcggcgac
gtgagctccaaccgcggttttgtgtttatcccagaggttggcgaccaggtgctgctgggc
ttccgacacggagaccctgggcgtccctatgttatgggcagcctgttcaacggttccact
ggtggcggtggcggtcagggcaacaagtgcaagagcctgaccacacgcagtggcagctcc
ctgaagctcgacgactcagacggcagtgttacgctgcatgacaagggcggagtgagtatg
aacttcgatggtgcaggaaattctacttttaattcaaatactagccatactgtaaatgca
ggaagtaatgcctctactaatgttggcgaaggtgcaagtgtgttgaatatggatagtggg
gggtgtgtagaacttactagtcagtccgaagtgagtataaaagtaggtagtgcttctatt
tctatgaataattcctctataactttaagtattggatcaagtagtattacattgacatca
gaaaatattttatcaaaaggtacgacgttatcaatggaatcaactacaagtacaagtata
tctggaggtcaaaatatagatatttcagctacacagaatcatattggtggagaaactaag
atggatggtggtgatgtttttgtaaattag

DBGET integrated database retrieval system