KEGG   Prevotella intermedia: PIN17_0496
Entry
PIN17_0496        CDS       T02058                                 

Definition
(GenBank) hypothetical protein
Organism
pit  Prevotella intermedia
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFJ07653
Position
I:527460..529217
AA seq 585 aa
MIDKRQQIIKERIQKFAMDLWNIADPRQVDPVIDLILDVIAYNSSRLYQSIDNSDSSILQ
RLARLLVPHKWSLPSPSHALMSVEPKDNDSCLLTPMDFFHTRKMIFDKGWVELDFSPLSN
YPLFNAEIKAISFDRRIIYNSKDGQQAGVFPDIDKKDEDNVVWVGFSMSESMLRSSQQLV
LCILPEDGSLAPFLKDIQAYDGEGKALNVTVPSFPLADSDKYQYFDNISAYYANNYIQID
LDTPTCSTFPQEWVCSDDTKEKDKLVWIKLKFPLAFHYVNFEKVRLLLNTYPVVNRSLVT
RRHNFAKQGNIVSLPCKGNRFLLNIESLQDDFNHKYMDVSKHYGENPVGTYNLYFGNLER
FDSDNARTLINKLLQLVREDGSAFKALDIDTLTAQLNELYHNIESIEKSVYESVQNKNNS
RAFLFTQPYKDINDAEVNYWVTDAEAANGLDSRASIYQYNNEKFSSSGLVFQTESKQGNS
HSGDQELINSLRYGLLTRERIVTREDVKSFLLCQLGQWIDSIKIEDGIAISQDVRRGIVR
TTEVKICLSRGGKAENIDLPAMTNFLEGELSKRSVSNTPYKIFFV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgattgataaaagacagcaaatcattaaggaacgtattcaaaaatttgcaatggatttg
tggaatatcgcagatccaaggcaggtggaccctgttattgatttgattcttgacgtaata
gcatacaatagcagtagactttatcaaagcattgacaattcagactcaagcattttgcag
cgtctggcgcgtttgttagtgccgcacaaatggtctcttccttcaccttcccacgctttg
atgagcgttgagcccaaagataatgattcttgtttactgacacctatggacttcttccat
acaaggaagatgatattcgataaaggttgggtagaattagatttttctcctttaagcaat
taccctttgttcaatgcagaaatcaaagcaatatcttttgaccgacgaataatatacaac
tcgaaagatggacaacaagcgggtgtttttcctgatatagacaagaaggacgaggataat
gtagtatgggttggattttcaatgtcagaaagcatgttgcgttcttcacagcagcttgta
ttgtgtattctacctgaagatggcagtcttgctcctttcttgaaagatatacaggcttat
gatggagaaggcaaggctttgaacgttactgttccaagttttccacttgccgatagtgat
aagtatcaatattttgacaatatcagtgcttactacgccaacaactatattcagatagac
cttgacacaccgacatgcagcacatttcctcaagaatgggtttgttctgatgatacaaaa
gaaaaggacaagttggtatggataaagctgaaatttcctttagcattccattatgtaaac
tttgagaaggtaagacttttgctcaacacctatcctgtagtaaatcgtagtttagttacg
agaagacataattttgctaagcaaggtaatattgtttcccttccttgtaagggtaaccgt
ttccttttgaatattgaatcattacaagatgatttcaaccataaatatatggacgtttcc
aagcattatggtgaaaatccagtgggtacatacaatctctattttggaaatcttgaaaga
ttcgactccgataatgcacgtacattaattaataaacttctccaattggttcgtgaagat
ggcagtgcgtttaaggccttagatatagatactctaacagcacaattgaacgaactttac
cataatatcgaaagtatagagaagagtgtttatgaatctgttcaaaataaaaacaattcg
cgtgcattcctattcactcaaccttataaagatatcaacgatgcagaggtaaactattgg
gttacagatgcagaggctgccaatggcttagatagccgtgcctctatatatcaatataat
aatgagaagttctcttccagtggattagtctttcagacagaatccaaacaaggtaattca
catagcggagaccaggaactcatcaatagtttgcgttatggtttgttaacaagagaacgt
atagtaacgcgcgaggacgtaaagagttttctgctatgccagttagggcaatggatagac
tctataaaaatagaagacggcatcgccatttcgcaagatgtacgacgaggtattgtccga
acaacagaagtaaagatttgcctctcacggggaggtaaagcagaaaatatagatttgccc
gcaatgacaaacttcttggaaggagagttgtcaaagcgttcagttagtaatactccttat
aagatatttttcgtatga

DBGET integrated database retrieval system