KEGG   Prevotella intermedia: PIN17_A1688Help
Entry
PIN17_A1688       CDS       T02058                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pit  Prevotella intermedia
Pathway
pit00010  Glycolysis / Gluconeogenesis
pit00052  Galactose metabolism
pit00500  Starch and sucrose metabolism
pit00520  Amino sugar and nucleotide sugar metabolism
pit00521  Streptomycin biosynthesis
pit01100  Metabolic pathways
pit01110  Biosynthesis of secondary metabolites
pit01120  Microbial metabolism in diverse environments
pit01130  Biosynthesis of antibiotics
pit01200  Carbon metabolism
Module
pit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PIN17_A1688
   00052 Galactose metabolism
    PIN17_A1688
   00500 Starch and sucrose metabolism
    PIN17_A1688
   00520 Amino sugar and nucleotide sugar metabolism
    PIN17_A1688
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PIN17_A1688
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PIN17_A1688
Enzymes [BR:pit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PIN17_A1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DUF460 TCR
Motif
Other DBs
NCBI-ProteinID: AFJ08492
UniProt: I1YTQ3
Position
II:complement(1753338..1754318)
Genome map
AA seq 326 aa AA seqDB search
MIEEQELKPFVIGLDLGGTNSVFGIVDQRGQVLATTSIKTQSYKIVEDFVDAGIEVLKPI
IAKVGGISQIKAMGIGAPNGNFYRGTIENAANLVWAHDSVVPLADMFSKRLGIPVGLTND
ANAAAIGEMMYGVARGMKDFIMITLGTGVGSGIVVNGQMVYGSDGFAGELGHVIMVRGEE
GRSCGCGRKGCLEAYCSATGVARTAREFLQKTKDPSLLRDINPEEITSLDVSIAAGKGDK
MALDIFAFTGDMLGAACADFANFSSPEAFVFFGGLTKAGDLLMNPIKAAYAKYVLPTYRD
NVKFLVSSLDDAAAAVLGASAIGWEI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagaacaagagcttaaaccattcgttataggattggatttgggaggcacgaac
tctgttttcggaatagtagaccaacgtggtcaggtacttgcaaccacatcaataaaaacg
caaagttataaaattgttgaggattttgtagatgcaggcattgaagtactgaagccaatc
attgccaaagtaggcggaatcagccagattaaggcaatgggaataggtgcgcctaatggc
aatttttatcgcggaactatcgagaatgctgcaaacttagtttgggcacatgatagcgtt
gtgccattggcagatatgttttcaaagcgtttaggcatacccgtaggtcttaccaacgat
gccaacgctgcagcaataggcgaaatgatgtatggtgtagcaaggggtatgaaagacttt
atcatgataactcttggcacgggcgttggttctggtattgttgtgaacggacaaatggtt
tacggttctgacggttttgcgggcgaactcggacacgttataatggtacgtggcgaagaa
ggtcgttcttgtggttgtggcagaaagggctgcttggaggcttattgctcggctacgggt
gtagcacgtacggctcgcgagttcttgcagaagacgaaagatccatcgttgcttcgtgat
ataaatcctgaagaaataacatcgctcgatgtgtcgattgctgcaggaaagggcgacaag
atggcattggatatatttgcctttacaggcgacatgcttggagctgcttgtgccgacttt
gcaaatttctcttcgccagaggctttcgtattctttggcggtctaacaaaggctggcgac
ttgcttatgaatcctatcaaggctgcttatgcaaagtatgtgttgcctacttacagagac
aatgtgaagttccttgtaagttcgctcgacgatgctgctgctgccgttttgggcgcatcg
gcaattggttgggaaatataa

DBGET integrated database retrieval system