KEGG   Prevotella intermedia: PIN17_A1726Help
Entry
PIN17_A1726       CDS       T02058                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pit  Prevotella intermedia
Pathway
pit00010  Glycolysis / Gluconeogenesis
pit00030  Pentose phosphate pathway
pit00051  Fructose and mannose metabolism
pit00052  Galactose metabolism
pit00680  Methane metabolism
pit01100  Metabolic pathways
pit01110  Biosynthesis of secondary metabolites
pit01120  Microbial metabolism in diverse environments
pit01130  Biosynthesis of antibiotics
pit01200  Carbon metabolism
pit01230  Biosynthesis of amino acids
pit03018  RNA degradation
Module
pit_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PIN17_A1726 (pfkA)
   00030 Pentose phosphate pathway
    PIN17_A1726 (pfkA)
   00051 Fructose and mannose metabolism
    PIN17_A1726 (pfkA)
   00052 Galactose metabolism
    PIN17_A1726 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PIN17_A1726 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PIN17_A1726 (pfkA)
Enzymes [BR:pit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PIN17_A1726 (pfkA)
Protein phosphatases and associated proteins [BR:pit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PIN17_A1726 (pfkA)
Messenger RNA biogenesis [BR:pit03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PIN17_A1726 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Phage_min_cap2
Motif
Other DBs
NCBI-ProteinID: AFJ09047
UniProt: I1YVA8
Position
II:complement(1782356..1783333)
Genome map
AA seq 325 aa AA seqDB search
MAKVKTIGILTSGGDAPGMNAAVRAVTRTGIYNGFSIKGIYRGYDGLLTGDIKTFTTENV
SGIIDEGGTILKTARSKAFMTKEGKEKAYENIVKEGIDALVVIGGNGSLTGAMNFAQEYD
LCCIGLPGTIDNDLYGTDSTIGYDTTLNTIMECVDRIRDTAQSHERIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDSTDVDQLARFMERGIRKSKKSCIVVVSESPKCGAMYYADRVK
KEFPNFDVRVSILGHLQRGGRPSARDRILASRTGYGAIEAIMQGQRNIMVGVRNNEVVYV
PLSEAIRSDKPFDKKLIKILDVLSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtcaaaacaattggtattttaacttcgggcggcgacgctccgggtatgaat
gctgccgttagagctgttactcgtactggaatttacaatgggttttctataaaaggaatc
taccgtggatatgatgggttgcttactggagatataaagacatttacaacagaaaatgta
agtggcattattgatgaaggtggaaccatcttaaagacggctcggtcgaaagcctttatg
accaaagaaggcaaggagaaagcctatgagaatattgtaaaggaaggaattgacgcactt
gtagtaatcggaggaaacggttctttgacaggagcaatgaactttgctcaggagtatgac
ctttgttgcataggtttgccgggcacaatagataacgacctctatggaacggatagcacc
ataggttacgatacaaccttaaacacaataatggagtgcgtggacagaatacgcgatacg
gcgcaaagccacgagcgcatcttctttgtggaagtaatggggcgcgacgctggtttccta
gcacaaaattcggcaatagcaagtggtgctgaggctgcaatcattcctgaagactcaacc
gatgtagaccagttggctcgatttatggagcgtggtattcggaagtcaaagaaaagttgt
attgttgtggtgtcagaaagtcccaaatgcggtgctatgtattatgctgaccgtgtaaag
aaagagtttccaaacttcgatgttcgtgtttcgatacttggacacttgcaaagaggagga
cgaccatcggcacgcgacagaatacttgcaagcagaacaggctatggcgcaatagaagcc
ataatgcaaggacagcgaaatataatggtaggagttcgcaataatgaggtggtttatgtg
ccgctttcagaagctattcgctccgataaacctttcgacaagaaacttattaaaatcttg
gacgtgcttagtatataa

DBGET integrated database retrieval system