KEGG   Paenibacillus sp. JDR-2: Pjdr2_1090Help
Entry
Pjdr2_1090        CDS       T00977                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00970  Aminoacyl-tRNA biosynthesis
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pjdr2_1090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pjd03029]
    Pjdr2_1090
Enzymes [BR:pjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Pjdr2_1090
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Pjdr2_1090
Mitochondrial biogenesis [BR:pjd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Pjdr2_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACS99769
UniProt: C6CVQ5
Position
1300000..1301460
Genome map
AA seq 486 aa AA seqDB search
MSLFDLRLQDVHSKLNNKELTVSDLVDASYRRIAETDETIKAFLTLNEENARRQADSLDK
QLLEGGERGLLFGLPSGVKDNIVTEGLLTTCASQFLSNYNPIYDATTVSKLKSAQSVTIG
KLNMDEFAMGGSNENSSYYPTRNPWNPEYVPGGSSGGSAASVAAGQVYFSLGSDTGGSIR
QPAAYCGIVGLKPTYGLVSRFGLVAFASSLDQIGPLTKNVEDSAYVLQAIAGYDEKDSTS
ANVDIPDYTSALTGDVKGLRIGVPREYLGEGIDPKVKEAVMQALKTFESMGATWEEVSLP
HTEYAIATYYLLASSEASSNLARFDGVRYGVRADNPENLIDLYRKSRSQGFGPEVKRRIM
LGTYALSSGYYDAYYLKAQKVRTLIKQDFDNVFNQYDIIIGPTAPTTAFKIGEQVGDPLT
MYLNDICTIPVSLAGIPAISVPCGTADGMPIGLQIIGKAFDESTVLRAAHAFEQQTEFHK
LRPQLG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttgtcactgtttgatttacgcctacaggatgtacatagcaagctcaataacaaagaattg
acggtttccgatttggtggatgcttcttaccgccggattgcggagacagacgaaacgatt
aaggctttccttacattaaatgaagagaatgcccgccgccaggcggatagcctggacaag
cagcttctggagggcggcgagcgcggccttctgtttggcttgccgtccggcgtaaaggat
aacattgtaacggaagggctgcttacaacatgcgcgagccaattcctgagcaactataat
ccgatttatgatgcaacaacggtttccaagctgaaatccgctcagtcggttacgatcggc
aagctgaacatggacgagttcgcgatgggcggctcgaacgagaactccagctactatccg
acgcgcaacccttggaatccggaatacgttccgggcggttcgagcggcggctctgcggct
tcggttgctgcgggacaagtctacttctcccttggctccgatacaggcggttcaattcgt
cagccggctgcctactgcggcattgttggcctcaagccgacatacggcctggtatcccgc
tttggtctcgtagcgtttgcttcttcattggatcagatcggtccgctcacgaaaaatgtt
gaagattccgcttacgtgctgcaagcgatcgcgggttacgacgagaaggattcgacatcc
gctaacgttgatattccggactacaccagtgctcttacgggcgatgtgaagggtcttcgc
attggcgtgcctagagaatatctgggcgaaggtatcgatcctaaggtgaaggaagccgtt
atgcaggctctcaaaaccttcgaaagcatgggcgcaacctgggaggaagtatcgcttccg
cataccgaatatgcgattgcgacttactatctgctcgcttcctcggaagcttcgtccaac
ctggcgcgttttgacggcgtccgttacggcgttcgcgcggacaacccggagaacctgatc
gacctgtaccgcaaatcgcgcagccaaggctttggcccggaagtgaaacgccggatcatg
ctgggtacgtatgcgcttagctccggttattacgatgcctattacctgaaagcgcagaag
gtccgtacgctgatcaagcaggacttcgataatgtcttcaaccaatacgatatcatcatc
ggccctacggctccgacaaccgccttcaagattggcgagcaggttggcgatccgctgacg
atgtacctaaacgatatttgtacgattccggtaagccttgcgggcattccggcaatcagc
gttccatgcggaacggcggacggcatgcctatcggcctgcaaatcatcggcaaggccttt
gatgaatcgaccgtgctgcgtgcggctcatgcgtttgagcagcaaaccgaattccataaa
ttacggccgcagctagggtga

DBGET integrated database retrieval system