KEGG   Paenibacillus sp. JDR-2: Pjdr2_1505Help
Entry
Pjdr2_1505        CDS       T00977                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00030  Pentose phosphate pathway
pjd00260  Glycine, serine and threonine metabolism
pjd00620  Pyruvate metabolism
pjd00630  Glyoxylate and dicarboxylate metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pjdr2_1505
   00620 Pyruvate metabolism
    Pjdr2_1505
   00630 Glyoxylate and dicarboxylate metabolism
    Pjdr2_1505
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pjdr2_1505
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     Pjdr2_1505
    1.1.1.81  hydroxypyruvate reductase
     Pjdr2_1505
    1.1.1.215  gluconate 2-dehydrogenase
     Pjdr2_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN
Motif
Other DBs
NCBI-ProteinID: ACT00178
UniProt: C6CWW4
Position
1796794..1797768
Genome map
AA seq 324 aa AA seqDB search
MRPKVYLSSKVSDEVKAYLDQYCECEMWQNPERAITGQELAEKIGDAEGLLAAGNAISER
LLSAAPKLRAVSNISVGYNHNDLDAMKKRGIIGTHTPYVLDETVADLTLALMLAAARRVT
ELHNLVRGGGWQRGVGEQLFGLDVHHAKLGIIGMGRIGEQIAKRAKFGFDMEVSYYNRSR
KPETEERLGVNYLGLNELLEQSDFIVLMTPLTPETKHMIGEEQFNRMKRTAIFINVSRGE
TVDEAALIEALRTKRIYAAGLDVYEKEPVSPDNPLLQLDNVVTLPHIGSATKKTRNDMAM
VAARNLVDALYGREPQYVIPELKN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcggccaaaagtgtacctatcatccaaagtatccgatgaggtaaaagcatacctcgac
caatattgtgaatgcgaaatgtggcaaaacccggagagagcgattaccgggcaggagctt
gccgaaaagatcggcgacgcggaagggctgcttgcagccggcaatgcaatcagcgagcgg
ctgctgagcgcagcgccaaagctgcgggcggtcagcaatatttcggtaggctataaccat
aacgatctggacgcgatgaaaaaacgcggcattatcggcactcatacaccgtatgtgctg
gatgagacggtggcggatttaacgcttgcccttatgctggcagcggccagaagagtaacg
gagctgcataatctcgtccgcggcgggggatggcagcggggcgttggcgagcagctgttt
ggactcgatgtgcatcacgcaaagcttggcattatcggaatgggacgcattggcgagcag
attgccaaacgcgccaaattcggttttgatatggaggtttcctactataaccgcagccgc
aagccggagaccgaggagcgccttggcgtaaattacctagggcttaatgagctgctggag
cagtcggactttatcgtgcttatgactccgcttacgccggagaccaagcatatgatcggc
gaagagcagtttaaccggatgaaacggaccgcgatctttattaacgtatcgcgcggcgag
acggttgacgaagcggctctgattgaagccctgcgcacgaaacggatttatgcggcaggc
ctcgatgtgtacgagaaggagccggtcagcccggataatccgctgctccagctcgataat
gtcgtgacgctgccgcatatcggttcggcaaccaagaagacgaggaacgacatggctatg
gttgcggcccgcaatctggtggatgcgctatatggcagagagccgcaatacgtgattccg
gaattgaagaattaa

DBGET integrated database retrieval system