KEGG   Paenibacillus sp. JDR-2: Pjdr2_2107Help
Entry
Pjdr2_2107        CDS       T00977                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00860  Porphyrin and chlorophyll metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pjdr2_2107
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Pjdr2_2107
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Pjdr2_2107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO NAD_binding_9 Pyr_redox_2 ApbA Pyr_redox FAD_binding_2 Thi4 Trp_halogenase FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACT00764
UniProt: C6CY65
Position
2488797..2490230
Genome map
AA seq 477 aa AA seqDB search
MVDRIVVIGGGISGLSSAFYLQREAERQGKQVKLTIVDGAPVLGGKINTLQRDGFVIEKG
PDSFLSRKLPIIELAKELGIENELTAQNENGKTSYIMKGGKLHPMPKGMVLGIPTNLDTF
MQTTLLSDEGKARSLLDLEMPRAAPEGDESLGDFLSRRIGAEIVKHISEPLLAGIYAGDL
SKLSIQATFPQFAEAERQYGSLIRGTQMQQKNKAPHQAPDYLPEELKNSVFLSFKEGLST
MVHALDQALQSVERRLGDAVVAINPLNGEDAASNYEVVLESGEVVPADHVLVTVPAFHAA
DLLEPLVDVTELRAINYVSVANVVMAFEKSTFDRAFDGSGFLVPRSEGLRITACTWTSNK
WLHTSPEDKVLLRCYVGRAGDEEVAMLPDDELKKAVLEDIQKVLGIDAVPVFTEITRLPR
SMPQYPVGHLENTAALRDRLAEELPGVYVTGAAFGGVGLPDCIRSGKEAALEILSTL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcgaattgtcgtaatcggcggggggatcagcggactgagctccgctttttat
ttgcagcgggaagcggagcggcaaggtaaacaggtgaagctgactattgttgacggcgcg
cctgttcttggcggaaaaattaatacgctgcagcgtgacggtttcgtcatagagaagggg
cctgattctttcctgtcgcggaagctgcctattatcgaactagcgaaagagctcggcatc
gagaatgaactgaccgctcaaaacgaaaacggcaaaacctcttatattatgaagggcggc
aagcttcatccaatgccgaagggcatggtgcttggcataccgaccaatctggatacgttt
atgcagacgactctgttatcggatgaaggcaaggctcgatcgcttctggatttggagatg
ccaagagcggcgccggaaggcgacgaatcgcttggcgattttctctcccgcagaattggc
gccgagattgtgaagcatatttcggagccgcttctggccggtatctacgcaggggatctc
agcaagctgagcattcaggcgacattcccgcagtttgcggaggcggaacgccaatatggc
agcctgattcgcggaacgcagatgcagcaaaagaacaaagcgccgcatcaagcgccggat
tatttgccggaagaactaaaaaacagtgtgttcttgagctttaaagaaggtttgtctacg
atggtgcatgcccttgatcaagctctgcaaagcgtagagcggcgtttgggtgatgccgtt
gtggcgatcaatcctcttaatggcgaggatgcggcttctaattacgaggttgttttagag
tcgggcgaggtagtgcctgccgatcatgtgctcgtcaccgtgccggctttccatgcggca
gatctgctagagccgctagtagacgtaaccgagctgcgggcaatcaactatgtatccgtc
gcaaatgtggttatggcgtttgagaaatcgacgtttgacagagcctttgacgggtcgggc
ttccttgtgccgcgttcggagggacttcgcattacagcttgtacctggacgtcaaacaaa
tggctgcataccagtcctgaagataaagtgctgctccgatgttatgtcggccgggcaggc
gatgaagaggtggctatgcttccggatgacgagttgaaaaaagccgtgcttgaagatatt
cagaaagtattgggtattgatgccgtgccggtttttacggaaataacacgtctgccgcgg
tcgatgccgcaatatcctgtagggcatctggagaatacggcagcgcttcgcgatcgtctg
gcggaagagcttccgggcgtatatgtaacaggcgcagcctttggcggagtaggattacct
gactgcatcagatcggggaaagaagcggctctcgaaattctatcgactctatga

DBGET integrated database retrieval system