KEGG   Paenibacillus sp. JDR-2: Pjdr2_2273Help
Entry
Pjdr2_2273        CDS       T00977                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00450  Selenocompound metabolism
pjd00970  Aminoacyl-tRNA biosynthesis
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pjdr2_2273
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pjdr2_2273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pjd01007]
    Pjdr2_2273
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pjd03016]
    Pjdr2_2273
Enzymes [BR:pjd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Pjdr2_2273
Amino acid related enzymes [BR:pjd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Pjdr2_2273
Transfer RNA biogenesis [BR:pjd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Pjdr2_2273
 Prokaryotic type
   Other AARSs
    Pjdr2_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: ACT00929
UniProt: C6CTZ0
Position
2660433..2662424
Genome map
AA seq 663 aa AA seqDB search
MGNDKKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYDVWYLTGTDEHGQKIE
RNAKDKNKSPQQFVDDIVVGIKELWSKLEISNDDFIRTTEPRHKEAVEKIFAQLLKQDDI
YKGEYEGWYCTPCESFFLERQLVNGNCPDCGRPVELVKEESYFFRMSKYADRLLKHYEEN
PDFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKHVIYVWIDALSNYITAL
GYGKEGSSDLYDRFWPADVHLVGKEIVRFHTIYWPIMLMALGLPLPKKVFAHGWLLMKDG
KMSKSKGNVVDPVTLIDRYGLDAVRYYLLREVPFGSDGTFTPENFVDRINFDLANDLGNL
LNRTVAMIDKYFDGEIPAYGGNVTAFDESLQVLAVETVRQVESSMETMEFSVALSAIWQF
VSRTNKYIDETSPWALAKDEAKKGELASVMYHLAESLRIISILLQPYLTHAPRELWRQLG
LEEGELTAWESTKRFGQLPGGTRVSKGAPVFPRLDAAEEVAYIAAAMGGGAAAKTEAAAP
AADNSAQAAAPAVEAKEEIGIEDFGKVELRVAQVIAAEPVQKADKLLKLQLDLGYEQRQV
VSGIAKFYTPEQMVGRKVICVTNLKPVKLRGELSQGMILAASHGDQLTLATVPDDMPNGA
IVK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgataaaaaaaccttttatattacgacaccgatctattatccgagcgacaag
cttcacatcggacatgcgtatacgacggtagccggcgatgccatggcacgctacaaaaga
cttcgcgggtacgatgtctggtacttgaccggtacggacgagcatgggcagaagattgaa
cgcaatgcgaaggacaaaaacaagtcgcctcagcagtttgttgacgatattgtcgttggc
attaaagagctctggtcgaaacttgaaatttcgaacgatgatttcatccgtacaacggag
ccgcgccataaggaagcggttgagaaaattttcgcccaattgctgaagcaggacgatatt
tataaaggcgaatatgaaggctggtactgtacgccatgcgaatcgttcttcctagagcgc
cagctggtgaacggcaactgtccggactgcggacgcccggtagagctggtgaaggaagag
agctatttcttccggatgagcaaatacgcggatcgccttctgaagcattacgaagagaac
ccggatttcattcaaccggaatcgcgcaagaacgaaatgatcaacaacttcattaagccg
ggtcttgaagatctcgcggtatcccgtacaaccttcgactggggtatcaaagtccccgga
gatcctaagcatgtcatctatgtatggattgatgctttgtcgaactacattacagctctt
ggttatggcaaagaaggcagcagcgatctgtatgaccgtttctggccggctgacgttcat
ctggtcggcaaggaaatcgtacgattccatacgatctactggccaatcatgctgatggcg
cttggcctgccgctgccgaagaaagtgttcgcgcacggctggctgttgatgaaggacggc
aaaatgtcgaagtcgaaagggaacgttgttgacccggtaaccctgatcgaccgttacggt
ctggatgcggttcgttattacctgctccgcgaagtaccttttggttccgacggcaccttc
actccggaaaactttgttgaccggatcaacttcgatctggcaaacgaccttggcaacctg
cttaaccgcacggtagcgatgatcgataaatatttcgacggcgaaattccggcttacggc
ggcaatgtaacggcgtttgacgagtctctgcaagtactggcggtagaaaccgtacgccag
gttgaatcgtctatggaaacgatggagttctctgttgcactgtcggcgatctggcagttt
gtcagccgcacgaacaaatatattgacgagacttctccttgggcgcttgcgaaggatgaa
gcgaagaagggcgaactggcttccgttatgtatcatctggcggagtcgctccgcattatt
tcgatcctgcttcagccttacctgacgcatgctccccgcgagctatggcgccagcttggt
ctggaagaaggcgaattgactgcttgggaaagcacaaaacgttttggccagctgccaggc
ggcacgcgcgtaagcaagggagcacctgtcttccctcgtctggatgcagccgaagaagtg
gcttatattgcggctgcgatgggcggaggagctgcggctaagacggaagcagctgcgccg
gcagcagacaattctgcgcaagccgctgcacccgcggtagaagcgaaggaagaaatcggc
atcgaggatttcggtaaggtcgagcttcgagtcgctcaagttatcgcagccgagccggtg
caaaaagccgacaagctgctgaagctccagctggatcttggctatgagcagcgccaggtt
gtatccggcatcgcgaagttctacacgccggagcagatggttggccgcaaagtgatttgc
gtaacgaacctgaagccggtgaagcttcgcggcgaactgtcgcaagggatgatcctggcg
gcttcgcatggcgatcaattaacgcttgcaacagtgccggatgacatgccaaacggcgca
atcgtaaagtaa

DBGET integrated database retrieval system