KEGG   Paenibacillus sp. JDR-2: Pjdr2_2311Help
Entry
Pjdr2_2311        CDS       T00977                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00900  Terpenoid backbone biosynthesis
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01130  Biosynthesis of antibiotics
Module
pjd_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pjdr2_2311
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pjd01006]
    Pjdr2_2311
Enzymes [BR:pjd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Pjdr2_2311
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Pjdr2_2311
    2.5.1.29  geranylgeranyl diphosphate synthase
     Pjdr2_2311
Prenyltransferases [BR:pjd01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Pjdr2_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ACT00967
UniProt: C6CU30
Position
2690190..2691098
Genome map
AA seq 302 aa AA seqDB search
MITDIKTYLHECAALVEKSLPEALPAEWNIPPQLRESMLYSLQAGGKRLRPALVLAAAEA
VHGQAAAARHALPVACAIEYIHTYSLVHDDLPAMDNDDYRRGKLTNHKVFGEAMAILAGD
ALLTHAFHLIPKVARLGGISAEVALDIVEDLAMLAGARGMVGGQAADMQGEQGITSIEEL
EYIHLHKTSDLIVFSVTAGGRIGGASAEQLEALRHYGRNIGLAFQIQDDILDLIGDEKKL
GKKTNSDVEQQKVTYPYLIGIDESKAQVKRLTREAKAAILEAQLDAPDKLLLIADYLVQR
DY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgattacagatatcaagacctacttgcatgaatgtgctgcgcttgttgaaaagtcgctt
cccgaagcgctgcccgccgaatggaatatcccgccgcagctcagggaatccatgctgtat
tccctgcaggctggaggaaaacggttacgtccggcactcgttctggctgccgcagaagcc
gttcacggccaggcagcggctgcccgccacgcgcttccggttgcatgcgcaattgaatat
attcacacctattcgttggtccatgacgacctgccggccatggacaatgatgattaccgc
cgcgggaaactgacgaatcataaggtattcggagaagcgatggcgattctggcgggggat
gccctgctgacgcacgcgtttcaccttattccgaaagtagcgcgccttggcggaatcagc
gccgaagtagctcttgatatcgtggaagaccttgccatgcttgcgggagcaagaggcatg
gttggcggtcaggcggccgatatgcagggagagcagggaatcacctcgattgaggagctt
gaatatattcatcttcacaagacgagcgatttgatcgttttctcggtaacggctggcggc
cgcatcggcggcgcatctgcggagcagcttgaagcgctgcgccattacgggcgcaatatc
ggtcttgccttccagattcaagacgacatacttgatctgatcggcgacgagaaaaagctt
ggcaaaaaaacaaacagcgatgttgaacagcaaaaggtgacgtacccttatctaattggg
attgatgagagcaaagcgcaagtcaaacgattaactcgtgaagcgaaggctgccattctt
gaagcacagctggatgcgccggataaattgctgcttattgccgattacctcgtccaacga
gactattga

DBGET integrated database retrieval system