KEGG   Paenibacillus sp. JDR-2: Pjdr2_2523Help
Entry
Pjdr2_2523        CDS       T00977                                 

Definition
(GenBank) glycoside hydrolase family 2 sugar binding
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00052  Galactose metabolism
pjd00511  Other glycan degradation
pjd00600  Sphingolipid metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pjdr2_2523
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pjdr2_2523
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pjdr2_2523
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pjdr2_2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 CBM_6 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: ACT01178
UniProt: C6CYG2
Position
complement(2900043..2903516)
Genome map
AA seq 1157 aa AA seqDB search
MSQKQKLNNDWFFSKHPLGTELDAILQGGIDWSPITLPHDWLIYDSNNLYENSIGWYRKA
IRFEDLPANKKFALRFEGVYMNSTVYVNGRVAGTWKNGYSTFEFDITSLLTRGENEILVQ
VIHESPNSRWYSGAGIYRPVWLITSPDTRIASDGIYISAKKNTSGTWSVDIDTEVVFANL
TDSSGIKLRHTILDAAATVISQSEALIQPESGSTAAFNQVLAVQQPRLWDLDEPSLYKLQ
TELIVEGNVLDSEEQNFGFRTFDFDTEKGFFLNGRPVKLQGVCQHHDLGSLGAAVNKTAL
RRQIALLQEMGVNAIRTAHNMPAVELMELADEMGVLIVSEAYDMWERAKTPYDFARFYKD
WWKKDIASWVRRDRNHPSMLMWSIGNEIYDTHADERGQTLTVELRDKVHFHDPKGNAVVT
IGSNYMPWENAQKCADLVQFAGYNYGDKYYKQHHEEHPDWYIYGSETCSTVQSRGIYHFP
LAQSVLADDDEQCSSLGNSSTSWGAKSTEACIIADRDAAFSLGQFLWTGFDYIGEPTPYH
TKNSYFGQIDTAGFKKDAFYIYQAEWTDYRVKPMVHIFPYWDFSEGQLIDVRVSSNAPKI
ELFFNDNSLGTYDIDHVHGQKLLGEWQIPYTKGILRAVAYDESGNVIATDIQSSFGDAET
VLLTPDKTAIAADGSDLVFIEISALDRNNLPVANANNRIHVTVEGPGRLVGLDNGDSADY
DSYKGTNRRMFSGKLLAVIAPTLESGTITVRAVSNGLAAGEVTLTAVAPEPSTPGNENTL
YAYAPGQAAETSSGSAASDDEIPVRKLEIICPQGNALSAENRALPVQVVIHPSQATYRDV
EWRVTNAAGVDANIATLEADGHHAAVNALSDGEFYIRCATKNGADNIRLYSLMEFRTDGV
GQAFINPYEFVSAGYHSESSRNLTNGNERGVATSRDGESWICFDNIDFGSYGADEITLPI
FSLDSERFTIDLWEGIPGEPSASLLAQITYQKPTKWNVYQEETYRLPRRLTGITSLSFVL
QRKIHLSGFQYKKAIKAFERLEALENNQIYGDTYTLTDQTIENIGNNVSLVFRDMDFGDT
GTSKLAICGQSPIDNNTIHILFSGADGETKQLVEFAYTEDYCEKEYALERITGLQTVTFM
FLPGSQFNFKSFQFLPE
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaaacaaaagctgaataatgactggtttttctccaagcacccactcggtaca
gagcttgatgccatcctgcaaggcggtatcgactggtcgcctattacactcccgcatgac
tggttaatctatgactctaacaatctgtatgagaacagcatcggctggtaccgcaaagcg
atccgcttcgaagaccttcccgcaaataagaagtttgcgcttcgctttgaaggcgtttac
atgaattcgacggtttatgtgaacggtcgtgttgccggtacgtggaagaatggctactcg
acctttgaattcgatatcacctccttgcttacaaggggcgaaaatgaaattctcgttcag
gttattcatgaatctccgaactcccgctggtattccggggcaggaatttacaggccggta
tggctcattacctcgccggatacccgtatcgcctccgacggcatttatatttccgctaaa
aagaatacaagcggtacctggtctgttgatatcgataccgaggttgtatttgcaaacctc
accgattcttccggaattaagcttcgacatacgatcctggatgccgcagcgacggttatt
agccagtccgaagcccttattcagccggagtccggctcgaccgcagccttcaaccaggtg
cttgcggttcagcagccgaggctttgggatctagacgagccgagcctctacaagctccaa
acggaattaatcgtcgaaggtaacgtattggattcggaagagcaaaacttcggcttccgc
accttcgatttcgataccgagaaaggcttcttcctgaatggccggcctgtcaagcttcaa
ggggtttgtcagcatcatgacctcggttctcttggcgctgccgtcaacaagacggccctg
agaagacaaatagccctcctacaggaaatgggcgttaacgcgatccggacagcccacaat
atgccggcggtcgagctgatggaattggccgatgagatgggcgtgcttatcgtctccgaa
gcgtacgacatgtgggaacgggcgaagacgccgtacgactttgcgagattttacaaggac
tggtggaaaaaagatatcgccagctgggtccgcagagaccggaaccatccaagcatgctg
atgtggagtatcggcaatgaaatctacgatacccatgccgacgaacgcggacagacgctg
acggtagaacttcgggacaaagtgcatttccatgatccgaagggcaatgccgttgtcaca
atcggttcaaactatatgccttgggagaatgctcagaaatgcgccgatctggttcaattc
gccggctataattacggggacaaatattataagcagcatcatgaggagcatccggactgg
tatatttacggcagcgagacctgctcgacggtacaaagccggggtatctatcacttcccg
ctcgcccagtccgttctggcggacgacgacgagcaatgctcctcgcttggcaacagctct
actagctggggagcaaaaagcacggaagcctgcattatcgctgaccgtgatgccgccttc
tccctcgggcaatttctgtggacgggcttcgattacatcggagagccaaccccttaccat
acgaagaactcctatttcggacagatcgatacggccggcttcaagaaggatgccttctat
atttatcaggcggaatggaccgattatcgcgtgaagccaatggttcatattttcccctac
tgggatttctcggaaggacagctgatcgatgtacgcgtctcttcgaatgcgccgaagatc
gagcttttcttcaacgataattcccttggaacgtatgacatcgatcatgtccacggccag
aagctgctcggagaatggcagattccttatacaaaaggtatccttcgggctgttgcttat
gacgagtcgggcaatgtgattgcaactgacattcaatcctccttcggtgacgcggaaacc
gtcctgctgacaccggacaaaacagcgatagccgcagacggctcggatctggtctttatc
gagatctctgctctcgaccggaataacttgccggtagccaatgccaataaccgtattcac
gtgaccgtagaagggcccggccgactcgttgggctcgataacggggacagcgccgattat
gattcttacaaaggaacgaaccgccgcatgttcagcggcaagcttctggcagtcattgcg
cctacgctggagagcggaaccattaccgttcgtgcagtatccaacgggttggctgccggt
gaagtgacgctgacggctgttgctcctgaaccatcaacaccgggtaatgaaaatactctg
tatgcctatgcacctggacaagctgcggagacttcaagcggatcagccgcttccgacgat
gagattcccgtgcgcaagctggaaattatttgtccgcaaggaaatgcgctttcggcggag
aaccgggctttgccggtacaagttgttattcatccaagtcaagctacgtatcgggatgtt
gaatggcgggtcacgaacgctgccggtgttgatgccaatattgcaacccttgaggcagac
ggccatcatgctgccgttaatgccctaagcgacggcgaattctatatccgctgcgcaaca
aagaacggagcggacaatatccgcctttattctttaatggagttccggaccgacggtgtc
ggacaagcttttattaatccgtatgaattcgtatccgcaggctaccatagcgaatcgagc
cgcaatctgacgaacgggaatgaacgcggcgtagcgacaagccgggacggcgaaagctgg
atttgctttgacaacatcgacttcggcagctatggtgcggacgagattacgctgccgatc
ttctcgctggacagcgaacggttcactatcgatctatgggaaggtattcctggcgagcct
tcggcttccctgcttgcccagatcacgtatcaaaagccgaccaaatggaatgtgtaccag
gaagagacgtatcgtttgccccgccggcttacaggcattacgtccctcagctttgttctg
cagcgcaagattcacctgagtggcttccagtacaagaaagcgatcaaagcatttgaacgt
ctggaggcgctggaaaacaaccagatttacggagatacttatacgctgacggatcagacg
atcgagaacattggcaacaacgtctcgctggtgttccgggacatggactttggggataca
ggcacaagcaagcttgcgatctgcggtcaatcgcctatcgacaacaatacgattcatatc
ctgttcagcggtgctgacggcgagaccaaacagctggtggagtttgcgtacacggaagat
tattgcgagaaagaatacgctcttgagaggatcaccggccttcagacggtcactttcatg
ttcctgccaggcagtcaattcaacttcaaatcgttccaatttctcccggagtaa

DBGET integrated database retrieval system