KEGG   Paenibacillus sp. JDR-2: Pjdr2_2636Help
Entry
Pjdr2_2636        CDS       T00977                                 

Definition
(GenBank) ribosomal RNA methyltransferase RrmJ/FtsJ
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pjd  Paenibacillus sp. JDR-2
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pjd03009]
    Pjdr2_2636
Enzymes [BR:pjd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Pjdr2_2636
Ribosome biogenesis [BR:pjd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Pjdr2_2636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_25 Methyltransf_11 THUMP Methyltransf_23 DUF956
Motif
Other DBs
NCBI-ProteinID: ACT01290
UniProt: C6CUT7
Position
3054745..3055764
Genome map
AA seq 339 aa AA seqDB search
MSRWIGTANQGYSPYAIEELRRLLDGVKVTQLAAGETFLFDSELSAEDVTAAVASDKPIF
LRHLQPVDRTVEIKGNADDLQELSETIRRSRLLFEDKQVAIHVRRSNKTAFPYSASDTKA
VLDAVLEELDAEPVVQHPDIIIAIYAAASELFIGFGKPEDMLSDWPGGAIRFQREEGQIS
RAKFKLLEAEREFGLDYSMFRSAVDIGAAPGGWTSLLLERGLRVTAIDPGDMHPSLAGHP
ALTYLKRNASEVKFKPGSFDLLVCDMSWSPMQMCRLVLDLEETLAPHASAIITIKLMHKK
PLQTIREVKERFSTAFIIKRAKQLFHNREEITLYLEKKQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgatggattggtacggctaatcaggggtattctccctatgcaattgaagagctt
cggcggctgttagacggcgttaaagtaacgcagcttgccgccggagaaacttttttattc
gacagcgagctttctgcggaagacgttaccgctgctgttgcgtcggacaagccgattttc
ctgcgacatttgcagcctgttgaccgtacggtagagatcaaaggcaatgcggatgatctg
caggagctgtcggagacgataagacgttcgcgtctgctgtttgaggacaagcaggtggct
atccatgtccgccgctcgaacaagacggccttcccgtattccgcttcggacacaaaggca
gtgctggatgcggtattggaggagctggatgcggaacccgtcgtccagcatccggatatt
atcattgccatttatgccgcggcaagcgagctgtttatcggctttggcaagccggaggac
atgctgtccgattggcctggcggagcgatacgattccaacgggaggaagggcaaatctcg
cgcgccaaattcaagcttcttgaagcggagcgggagtttgggttggattattccatgttc
cgtagtgccgtggacattggagcggctcctggcggctggacatccctgctgcttgaacgg
ggtctgcgggtaacggcgattgatccgggagacatgcacccgtcgctggcaggtcatcct
gcattgacgtacctgaaacggaatgcatcggaggtcaagttcaagccgggttcctttgat
ctgcttgtatgcgatatgagctggagccccatgcagatgtgccgtctggtgcttgatttg
gaagagacgctggcaccgcatgcctcggctattattacgataaagctgatgcacaaaaag
cctcttcagaccattcgcgaggtcaaggaacgtttttcaaccgcatttatcattaaacgc
gccaagcagttattccataaccgcgaggagattacgttatacctggaaaagaagcagtag

DBGET integrated database retrieval system