KEGG   Paenibacillus sp. JDR-2: Pjdr2_2652Help
Entry
Pjdr2_2652        CDS       T00977                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00010  Glycolysis / Gluconeogenesis
pjd00020  Citrate cycle (TCA cycle)
pjd00620  Pyruvate metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Module
pjd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_2652
   00020 Citrate cycle (TCA cycle)
    Pjdr2_2652
   00620 Pyruvate metabolism
    Pjdr2_2652
Enzymes [BR:pjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pjdr2_2652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ACT01306
UniProt: C6CUV3
Position
3070571..3071875
Genome map
AA seq 434 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIVKVHIKAGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVLEV
RMKDGQVCHVGEVVAIIDAEGDIPEQDTPAAEAPAAAPAPAAAPAAPAAAPAAAPAAPAE
APKATGGLVLATPSVRKFAREQGVDLTTVTGTGKNGRITREDVTNGGGAAPAAAAPATDA
AAPAAAEAPAAKPAAAAVDAYRPEERVPFKGIRKAIANAMVKSVYTAPHVTIMDEVDVTE
LVALRAKYKPYAEKKGSKLTYLPFIVKALVAACRQFPIMNATLDEANQEIVYKKFYNIGI
ATDTDNGLIVPVIEDADRKNIFMVADKIRDLAVKGREGKLSAAELKGSTITISNIGSAGG
MFFTPVINFPEVAILGTGRISEKPVVRNGEIVAAPVMALSLSFDHRLIDGATAQNFMNYI
KQLLGQPELFIMEV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaatttgaatacaaatttccggagcttggcgaaggcttgcacgaaggcgaaatc
gtaaaagtgcacattaaagccggcgacaaagtaacggatgacgatatcatcatggaagta
caaaacgataaggcagttgtagaagtgccttgcccggttaacggtactgtactcgaagta
cgcatgaaagacggccaggtttgccatgttggcgaagttgtggccatcattgatgcagaa
ggtgatattccagagcaagatactcctgctgctgaagctccagcggcggcaccagcacca
gcggcggcgcctgctgcaccggcagcggcaccagcggcagctcccgctgcaccggcagaa
gctccgaaagcaacaggcggtttggttctggctacgcctagcgttcgtaaatttgcccgc
gagcaaggcgttgacctgacgacggttaccggcactggcaaaaacggccgtattactcgt
gaagacgtaacaaacggcggcggtgcagcaccagcggcggcagctccggcaacggatgcg
gcagctcctgcagcagcagaagcaccagcagctaaaccggcagcagcggcagttgacgca
taccgtccggaagagcgcgtaccgttcaaaggcatccgtaaagcaattgccaacgcgatg
gttaaatcggtatacacagctcctcacgtaacaatcatggatgaagttgacgtaactgaa
ctggttgctctgcgcgcgaaatacaagccgtatgcagagaaaaaaggttccaagctgact
tacctgccattcatcgtgaaggcactcgttgcggcttgccgtcaattcccgatcatgaac
gctacgctggatgaggctaaccaagagatcgtctacaagaagttctataacatcggtatt
gctacagatacagacaacggcctgatcgttcctgttatcgaagacgctgaccgtaaaaat
attttcatggttgccgacaaaatccgcgacctggctgttaaaggccgcgaaggaaaatta
tccgctgcagagcttaaaggcagcacgatcacaatttccaacatcggttccgctggcggt
atgttctttactccggtaatcaacttccctgaagttgcgatcctgggtactggccgtatc
tccgagaaaccggttgttcgcaacggagaaatcgtggcagctcctgtaatggctctgtcg
ctgagcttcgaccaccgtctgatcgacggcgcaactgctcaaaactttatgaactacatt
aaacaacttctgggtcaaccagaattattcatcatggaggtgtaa

DBGET integrated database retrieval system