KEGG   Paenibacillus sp. JDR-2: Pjdr2_2766Help
Entry
Pjdr2_2766        CDS       T00977                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00071  Fatty acid degradation
pjd00280  Valine, leucine and isoleucine degradation
pjd00310  Lysine degradation
pjd00362  Benzoate degradation
pjd00380  Tryptophan metabolism
pjd00620  Pyruvate metabolism
pjd00630  Glyoxylate and dicarboxylate metabolism
pjd00640  Propanoate metabolism
pjd00650  Butanoate metabolism
pjd00900  Terpenoid backbone biosynthesis
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
pjd01212  Fatty acid metabolism
pjd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pjdr2_2766
   00630 Glyoxylate and dicarboxylate metabolism
    Pjdr2_2766
   00640 Propanoate metabolism
    Pjdr2_2766
   00650 Butanoate metabolism
    Pjdr2_2766
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pjdr2_2766
   00072 Synthesis and degradation of ketone bodies
    Pjdr2_2766
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pjdr2_2766
   00310 Lysine degradation
    Pjdr2_2766
   00380 Tryptophan metabolism
    Pjdr2_2766
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pjdr2_2766
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pjdr2_2766
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pjdr2_2766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pjd04147]
    Pjdr2_2766
Enzymes [BR:pjd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pjdr2_2766
Exosome [BR:pjd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pjdr2_2766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACT01419
UniProt: C6CYX8
Position
3194594..3195772
Genome map
AA seq 392 aa AA seqDB search
MSNRQSVIVAGARTAFGKFGGQFKSVPAVQLGASAIDGAIQRSGISPGQVDGVIMGMVLQ
AGAGQIPSRQAARLAGLSWEIPSETINKVCASGMRAITMADQMIRSGDAEIVVAGGMESM
SRTPYAVPAARWGARMGNAALVDLMNHDGLFCAFHQVPMGSLGNRVADEFNIGRQEQDDW
ALRSHLRAVAAQQSGRFAEEIVPVILDDGTQHHVDECPRPDTDAAKLAKLKPAFDRTGTI
TAGNAPGVNDGAAAVTVMSTVEAARLGVKPLATILGHASAGAEAAYLATVPALAIRKLLK
QTGVPLEKIDLFEVNEAFASVVLISGQMLGWDHEKVNVNGGAIALGHPIGASGARIVLTL
IHELKRRGGGLGIAAICSGGAQGDAILLEVNA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcgtcagtcggttatcgttgcgggagcaagaacagcatttggcaagtttggc
ggccagttcaaatccgtaccagccgttcagctaggagcttctgcgattgatggcgccatt
caaagatccggcatttcacccggtcaggtggatggcgtcattatgggcatggtgcttcag
gcgggagccggccagattccgtccaggcaagcggcaaggctggcgggtctaagctgggaa
ataccgtcggagacgataaacaaggtttgcgcatcaggcatgcgtgccatcacgatggcc
gatcaaatgattcgttccggcgatgccgagatcgttgttgcaggcggcatggaaagcatg
agccgcaccccatacgccgttccagcggcgagatggggcgctagaatgggcaatgcggca
cttgttgatctaatgaatcatgacggtttattttgcgcgttccatcaggtgccgatgggc
tcgcttggcaaccgtgtggcagacgagttcaatatcggacgtcaagagcaggacgattgg
gcccttcgaagccacttgcgcgcggtagctgcacaacagagcggccgctttgccgaggag
atcgttcccgtcattctggatgacggtacgcagcatcatgttgacgagtgtcctcgtccg
gatacggatgcggcaaagcttgccaaattaaagcctgctttcgaccggaccgggacgatt
acggccggcaatgctcccggcgtgaatgacggcgccgctgcggtgacggtcatgtctacg
gtagaagccgctcgtcttggtgtcaagccgcttgcgaccatacttggccatgcttcggca
ggcgcggaagctgcgtatttggcaaccgtcccggcgcttgcgatccgtaagcttctgaag
cagacgggagtaccgcttgagaagattgatctttttgaagtgaacgaagctttcgcttcg
gttgtgctgatcagcggacaaatgcttggctgggatcacgaaaaagtaaacgtcaacggc
ggagcgatcgcgctggggcatccgattggagcgagcggcgcccgcattgtgttgacgctg
attcatgaactgaagcgtcggggcggcgggttagggattgccgcgatttgcagcggcgga
gcgcaaggcgacgcgattttgcttgaggttaatgcttga

DBGET integrated database retrieval system