KEGG   Paenibacillus sp. JDR-2: Pjdr2_3282Help
Entry
Pjdr2_3282        CDS       T00977                                 

Definition
(GenBank) fructose-16-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00010  Glycolysis / Gluconeogenesis
pjd00030  Pentose phosphate pathway
pjd00051  Fructose and mannose metabolism
pjd00680  Methane metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_3282
   00030 Pentose phosphate pathway
    Pjdr2_3282
   00051 Fructose and mannose metabolism
    Pjdr2_3282
  Energy metabolism
   00680 Methane metabolism
    Pjdr2_3282
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Pjdr2_3282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ACT01920
UniProt: C6D1Q6
Position
3751989..3753920
Genome map
AA seq 643 aa AA seqDB search
MDAQFLDLLAQKYDTEEKVVTEIINLEAISNLPKGTEHFVSDLHGEFQAFQHVLRNGSGT
VKEKIKALFREDWTDHEINDFTALVYYPEEKIQLVKGDLCNKQALNRWYRKTIEQMLKLI
SFASSKYTRAKLRKALPEQFVYIVEELLYKTDLTNNKDPYYEEIYRQIISLGQADKLIIG
LAYTIQRLVVDHLHVVGDIYDRGPDPDKIMDTLIDYHSVDIQWGNHDVLWIGAYAGSLVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYNDNPAFRPKLQTDHNGSEQEILQI
TKIHQAIAMIQFKLEIPIIKRRPYFNMSNRLLLEQIDYDKNEIKIGGKTYPLENTCFATV
NPQQPEQLLEEEQQVMEKLLLSVQHSEKLARHMSFLMKKGSLYLIYNGNLLFHGCIPLDE
EGNMEEMQIEDKKYSGRQLLDVFEYYLRYAFAHPEDTDDLATDMVWYIWTGECSSLFGKK
EMTTFERYFIQDKETYKERKNPYYHLREVEEICRKILLEFVMNPDHGHIINGHTPVKEIR
GENPVKANGKMVVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQKFISKEDVLCNGTD
VLSVKRLVDKELERKLVRETNVGEKLLQKISNLKNLLEYRYMK
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcgcagtttctagatttattagcccagaaatatgatacggaagaaaaagttgta
acagaaatcatcaaccttgaagcgatctccaatcttcccaagggaactgagcattttgtc
agtgatttgcatggggagttccaagcttttcagcatgtactaagaaacggttcaggcacc
gtaaaagagaaaatcaaagccttgttccgtgaggattggacggatcatgaaatcaatgat
tttacggcgttagtctattatccggaagaaaaaatacagctggttaaaggagacctgtgc
aataaacaagccttaaaccgatggtatagaaaaacgattgaacaaatgcttaagctcatt
tcattcgcctcatccaaatatacgcgggccaaattgcgcaaggctctgccggagcagttc
gtatatattgtagaagagcttctatacaagacggatttgaccaacaataaagacccttat
tatgaggaaatataccggcaaattatttccttgggccaggcggacaagcttattattggc
cttgcttatacgatccagcgcctggtggttgaccatcttcatgtggtcggggatatctat
gatcgcgggccggaccccgataaaatcatggacacgctgatcgactaccattccgtagac
attcagtgggggaaccatgatgtcctgtggattggcgcctatgcgggttccttggtctgc
cttgcgaatattatccggatctgcgccagatacgacaatctggacatcatcgaagacgta
tacggaatcaatcttcgtccactgctcaatttggcggagaaatactataatgacaatccg
gcttttagaccaaagctgcagaccgaccataacggctcggagcaggaaatcctgcagatc
accaaaattcatcaagccattgccatgattcagtttaagcttgaaatcccgattatcaag
agacgcccatactttaatatgtctaacaggcttttgcttgagcagatcgattacgacaag
aatgaaatcaagatcggcggaaaaacttacccgctggaaaacacctgttttgcaaccgta
aatccgcagcagcctgaacaattgctggaggaagaacaacaggtaatggaaaagctgctg
ttatccgttcagcattccgaaaagctggccagacatatgagttttcttatgaaaaagggt
agcctttatttaatatataacgggaatttgttatttcacggctgcattcctttggatgaa
gaaggaaacatggaagaaatgcagattgaagacaagaagtattcgggccgtcagttgctc
gatgtttttgaatattatttacgttacgcctttgcgcacccggaagatacggatgatctg
gctacggatatggtatggtacatctggacaggggaatgttcgtcgctctttggaaagaaa
gaaatgaccacctttgaacggtactttatccaagataaagaaacctataaggagagaaag
aacccctattaccatctgcgtgaagttgaggagatatgccggaaaatcctgctggagttt
gttatgaatccggatcatggtcatatcattaacggccacacgcctgttaaagaaattcgt
ggagagaaccccgttaaagcaaacgggaaaatggttgtcattgacggcggtttttccaaa
gcctatcaatccacaacgggcatcgccggatataccttgttgtataattcctttggcatg
cagctcgttgcccatcagaaatttatttcaaaagaagatgtgttatgtaacggaacggac
gtattgtctgtaaaaaggctggtggacaaagaactggagcggaagctggtgagggaaacc
aatgtcggggagaagctgctgcagaaaatctcaaatttgaagaatctcctagaatatcgc
tatatgaaatga

DBGET integrated database retrieval system