KEGG   Paenibacillus sp. JDR-2: Pjdr2_3901Help
Entry
Pjdr2_3901        CDS       T00977                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00220  Arginine biosynthesis
pjd00330  Arginine and proline metabolism
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01130  Biosynthesis of antibiotics
pjd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Pjdr2_3901
   00330 Arginine and proline metabolism
    Pjdr2_3901
Enzymes [BR:pjd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Pjdr2_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACT02531
UniProt: C6D566
Position
complement(4449016..4449909)
Genome map
AA seq 297 aa AA seqDB search
MNKLTLLSVPFGLGAGTPGSEQAPRHIYQLGLFQMLQQQGCTINKLKEIINAGIPAPVIQ
VPMNHSEEVIKTGIALARAVKAVVSSGQFPFVLGGDHSLAMGTLAGLTSHYKKLGVIWID
AHADMNTESTSPSGNMHGIPLAVAQGRAQLSLSHLLPGAGTIAPGNIVLIGARDLDPAEE
AFIQAEGISCFRMDDIRRLGIHAVITEALRIAGDGADGIHLSFDIDSVDPAEAPGTGTPV
HGGLTADEAREAIRMLGISKRMTSAEFVEVNPLLDHLDQTSLLAMELIVLFLSSMKS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcttactttgttatccgttccctttggtcttggcgcagggacacccggcagt
gagcaagccccccgccacatctatcagctgggcctttttcaaatgctgcagcagcaaggc
tgcacgattaataagctgaaggaaatcataaacgccggtattcctgctcccgttattcag
gttccgatgaaccattccgaggaagtcatcaagacgggaatcgcattggcccgggccgta
aaagccgttgtatcttccggacagtttcctttcgttcttggcggagatcatagtctggcg
atggggacgttagccggattgacctcgcattataagaagcttggcgtcatatggattgat
gcgcatgccgatatgaacaccgaatcaaccagcccttccggcaatatgcacggcatcccg
ctcgccgtcgcccaaggaagggcgcagctgtctttatcccacttattgccgggagcgggt
acaatcgctcccggcaatattgtccttatcggagcccgggatctggatcctgcggaggaa
gcgtttatccaggcggagggaatttcttgtttccgcatggacgacattagacggcttggc
attcatgcggtaatcaccgaagcgcttcgcattgcgggagacggggcggacggcatccat
ctcagctttgatatcgacagcgttgatcctgccgaagctccggggacgggtactccggta
catggcggtttaacagcggacgaagcccgggaggctatccgcatgctaggcatatccaaa
cgcatgacctccgccgagttcgtagaggtgaatccgctgcttgatcacttggatcaaacc
tctttgctggcaatggagctgatcgtgttgtttttgagcagtatgaagagttaa

DBGET integrated database retrieval system