KEGG   Paenibacillus sp. JDR-2: Pjdr2_4221Help
Entry
Pjdr2_4221        CDS       T00977                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00030  Pentose phosphate pathway
pjd01100  Metabolic pathways
pjd01120  Microbial metabolism in diverse environments
pjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pjdr2_4221
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Pjdr2_4221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase PALP 3HCDH_N Polysacc_synt_2 AdoHcyase_NAD THF_DHG_CYH_C GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: ACT02848
UniProt: C6D745
Position
4832899..4833642
Genome map
AA seq 247 aa AA seqDB search
MSHSLIGKSALVTGAGTGIGKGIALALAKRGAKVAIHYNSSDAGAKDTQHQIEELGGECI
TVQADVADRGQVIRMVDTAAAELGGIDILVNNAALQLNIPWFEYTEELYDRVMNINLKGY
WQCMQTVIPYMKERHFGRIINISSVHGKRPTDFDVVYCMSKGGIKMLGRESAIELARYGI
TVNTIAPGAVDVGKFKASHKEPNRKKFPLGRVGLPEDIASLACYVASDEASFMTGSTIRV
DGAGMLM
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagccacagcttgataggaaaatcggcacttgtcaccggcgcgggaacgggcatcggc
aaaggtattgccttagcgctggcaaagcgcggcgcgaaggttgccattcactataattcc
agcgatgccggagccaaagatacgcagcatcaaatcgaagagcttggcggcgagtgcata
accgtgcaagccgacgtcgccgaccgggggcaggttatccgcatggtcgacacggctgca
gctgagcttggcggcatagacattctggtcaacaatgccgctcttcagttaaacatccct
tggtttgaatatacggaagaactatacgaccgcgtcatgaacattaaccttaaagggtac
tggcaatgcatgcagacggttatcccttacatgaaggaacggcattttggccgcattatt
aacatttcctccgtgcatggcaaaagacctaccgatttcgacgttgtgtactgcatgtcg
aaaggcggcatcaaaatgctcgggagggaaagcgctattgagctagcacgttatggcata
acggtcaatacaatcgcgcccggtgcggtcgacgtaggcaagttcaaggcatcgcataag
gaaccaaaccgcaaaaaattcccgcttggacgcgtcggactacctgaggacattgcttca
ctagcctgctacgtggcctctgacgaagcttcgtttatgaccggctccaccatccgcgtg
gatggtgccggcatgttgatgtaa

DBGET integrated database retrieval system