KEGG   Paenibacillus sp. JDR-2: Pjdr2_4986Help
Entry
Pjdr2_4986        CDS       T00977                                 

Definition
(GenBank) phospholipase D/Transphosphatidylase
  KO
K06131  cardiolipin synthase A/B [EC:2.7.8.-]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00564  Glycerophospholipid metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pjdr2_4986
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     Pjdr2_4986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 PLDc PLDc_N Regulator_TrmB
Motif
Other DBs
NCBI-ProteinID: ACT03597
UniProt: C6D0J8
Position
complement(5700999..5702435)
Genome map
AA seq 478 aa AA seqDB search
MIGWLTAIIIFLLLYSAQPVVIVWIERRLPAKAAAWIVIALAVPVLGFAGYWMVGRSRRV
KEGRAVSREYEQAAERLSICAAGPGELGQSGLLEQEQLLRLLRVCSGRPVTLGNQVKVLT
NGRETFASILEEMKQASHHIHLDYYTIRDDGIGREFLNILTAKAKAGVEVRVLYDGIGSV
KLSKRYVRELKRSGVQVSCFSPPGAALLNRLLNSRNHSKIAVIDGKVGFVGGINIGDEYL
GKDKKLGFWRDTQLRLEGDAVYFLQELFMKDWELAVKERLPVNAGYMPEHDPDEALQEPV
LIVSSGPDRSGEPILETAFAAVKAARTSVYISTPYFIPDESLLAMLGSAAKSGVDVRLVI
PGIPDTQLVLWATLSFVERMLEAGVRVYRYQKGFIHAKVMIVDELLAVVGTANMDMRSFH
SNFEQNAVLFDAGTIKHLKRDYEQDLLDSRELDLEDFRQRPKKEKAAEAAARLLSPLL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatcggttggcttacggcaataatcatatttttactcctgtatagcgctcagcctgtc
gtcattgtatggatcgaaagacgtcttccggcgaaagcggctgcatggattgtcattgcg
ctggccgttcctgttcttggttttgcgggatattggatggttggccgttcgagacgcgtc
aaggaaggacgggcagtctcgagagaatacgagcaagctgccgagcgtttgtctatttgt
gctgccggtcccggcgagcttgggcaatccggcttactggagcaagaacagctgcttcga
ctcctgcgcgtttgttccggcagaccggttacgttaggcaaccaagtgaaggtgctgaca
aacgggcgggagacgtttgcctctatattagaagaaatgaagcaagctagtcaccatatt
catctggactattacacgatccgcgatgacggaattggccgggagtttttgaatatcctg
accgccaaagccaaggcaggcgttgaggtacgcgtgttgtatgacgggattggaagcgtc
aaattaagcaagcggtatgttcgcgagctgaagcggtcgggcgtgcaggtaagctgtttt
tcaccgccgggcgcggctttgctcaatcggctcctgaacagccgcaatcacagcaagatt
gctgtaattgacgggaaagtcggatttgtaggcggcatcaatatcggagacgagtatttg
ggcaaggataagaagcttggattttggcgggatacgcagcttcggcttgaaggggatgcg
gtttatttcctgcaggagctgtttatgaaggattgggagctggccgttaaggaacgtctg
ccggtgaatgcaggttatatgccggagcatgatccggatgaagctttgcaggagccggtg
ttaattgtgtccagcgggcccgaccggagcggtgagcctatcctggagacggcgtttgct
gccgtaaaagcggcccggacaagcgtctatatttcaacgccgtattttataccggatgag
agtctgctagccatgctagggagtgccgcaaaaagcggggtagatgtgcggctcgttatt
cccggtattccagacacgcagctcgttttatgggcgaccttgtcgtttgtagagcggatg
ctggaagccggggttcgggtgtaccgttatcagaaaggcttcattcacgcaaaagtgatg
atcgtggatgagctccttgcggtagtgggaacggccaatatggacatgagaagctttcac
agcaacttcgagcaaaatgcggtattgttcgacgctgggacgatcaaacacttgaagcgg
gattacgagcaggatctgctcgacagccgcgagcttgatctggaagactttcggcaaagg
ccgaaaaaggaaaaggcagcggaggccgctgccaggctgttatcgccgctcttgtaa

DBGET integrated database retrieval system