KEGG   Paenibacillus sp. JDR-2: Pjdr2_4988Help
Entry
Pjdr2_4988        CDS       T00977                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00521  Streptomycin biosynthesis
pjd00523  Polyketide sugar unit biosynthesis
pjd00525  Acarbose and validamycin biosynthesis
pjd01130  Biosynthesis of antibiotics
Module
pjd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pjdr2_4988
   01055 Biosynthesis of vancomycin group antibiotics
    Pjdr2_4988
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pjdr2_4988
   00525 Acarbose and validamycin biosynthesis
    Pjdr2_4988
Enzymes [BR:pjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Pjdr2_4988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 Sacchrp_dh_NADP NmrA KR
Motif
Other DBs
NCBI-ProteinID: ACT03599
UniProt: C6D0K0
Position
complement(5703435..5704454)
Genome map
AA seq 339 aa AA seqDB search
MKLLITGGAGFIGSNFVHYMMSRYPDYEFINVDALTYAGNPENLRQVENHPHYTFVKADI
ADQAALTPLFESGIDAVINFAAESHVDRSILQPGLFVHTNIVGTQTLLDLSKTHQVKRYV
QVSTDEVYGTLGAAGLFTENTPLAPNSPYSASKAGADLLVRAYHETYGLPAVITRCSNNY
GPYQFPEKLIPLMILNALQDKPLPVYGDGLQIRDWLYVEDHCKAIDLVLHQGRIGEVYNV
GGSNERTNLHVVRTILQELGKPESLIRHVEDRPGHDRRYAIDADKIKSELGWTPEHSFEN
GIKSTIEWYLHNEEWLEQVVSGAYRKYYDTQYAKRLESK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttaattacgggcggagcggggttcatcgggagcaacttcgttcattatatg
atgagccgttatcccgattacgagttcattaacgttgatgccttaacgtatgcgggcaac
ccggaaaatctccggcaggtggagaatcatccgcactatacgtttgtcaaagcggatatt
gccgatcaggcggcgcttaccccgctgtttgagtcgggtattgacgcggtcattaacttt
gccgcggaatcccatgtagaccgcagtattttgcagccgggactgtttgttcatacgaat
atcgtcgggactcagacgttgttagatttgtccaagacgcatcaggtgaagagatacgtg
caggtatcgacggatgaagtgtacggtacgcttggtgcggctggactgtttacggaaaac
acgccgcttgcgcctaacagtccgtattcggcaagcaaagccggagcagatttgcttgtc
cgcgcttatcacgagacatacggtctgccggctgtcattacgcgctgttcgaataactat
ggaccgtatcaatttccggaaaagcttattccgctgatgattctcaatgcgctgcaggat
aagccgctgccggtttatggcgacggtcttcagatcagagattggctgtatgtcgaggat
cattgcaaagcgatcgatctggtgcttcatcaaggccggattggcgaagtgtacaacgtt
ggcggcagcaacgaacggaccaatcttcatgtggtgagaaccatcctgcaggagctgggc
aagccggaatcgctgatccgccatgtggaggaccgtcccggacatgaccggcgctacgcg
attgatgcggataaaatcaaaagcgagcttggatggacaccggagcatagcttcgagaac
gggattaaatcgacgatcgaatggtatcttcacaatgaagaatggctcgagcaggttgta
tccggcgcgtataggaaatattacgatacgcagtatgcgaagaggctggagtccaaatga

DBGET integrated database retrieval system