KEGG   Paenibacillus sp. JDR-2: Pjdr2_4990Help
Entry
Pjdr2_4990        CDS       T00977                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
pjd  Paenibacillus sp. JDR-2
Module
pjd_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pjd02000]
    Pjdr2_4990
Transporters [BR:pjd02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Pjdr2_4990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane ABC2_membrane_5 TctB DUF2705 ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ACT03601
UniProt: C6D0K2
Position
complement(5705237..5706031)
Genome map
AA seq 264 aa AA seqDB search
MFNFFKLVQNENMKIYRRPRTYVMLGILLALIAAISIIGYFVDQNHTTAAWSMIMTEVMI
AYLLITVFTIIIASSGVAEEFTSGTIKLLLIRPWTRSKILLSKYIAVLLYALGMVIVMLL
FTIVLNMILFDTSDNTATDIISPLVSGSIAAYLIKYALLKYVSLIVTTTLAFMLATVSRS
GALAIGLSLFLILGVNSFTPLLAALKYKWADYILFIHLDLTQYLNDTPMRDGLTLGFSIA
VLAVYYAIFMALAWYVFKKRDVAA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaatttttttaagctggttcagaatgaaaacatgaaaatctaccgccgcccgcgg
acgtatgtcatgctgggaatcttgcttgctttgatcgcggcgatttcgattattggttat
ttcgtggatcaaaatcatacgactgccgcatggagcatgatcatgacggaagtcatgatt
gcttatttgcttattacggtatttacgattattatcgcttcctccggcgtagccgaagag
ttcacgagcggtacaatcaagctgcttctgattcgtccatggacaagatccaaaatcctg
ttgtccaagtatattgccgttcttctgtatgcgcttggcatggtcattgttatgctgctg
tttaccatcgtgctgaatatgattctgttcgataccagcgacaacacggcaaccgatatt
atttccccgcttgtctcgggctccatcgcggcttatttgatcaagtacgccctgctgaag
tatgtgtcgctgatcgtcacaacaacgcttgcctttatgctggcgaccgtatcccgcagc
ggcgcgctcgctatcggcttgtcgctgttcctgattctgggggttaattcctttacgcca
ttgctggccgcgctcaagtataaatgggcggattacattttgttcatccatcttgacctt
acgcagtatttgaatgatacgccgatgcgcgacggtttaacattaggcttctcaattgct
gtcctggccgtctattatgccatctttatggctctagcctggtatgtcttcaagaagagg
gatgtagcggcttaa

DBGET integrated database retrieval system