KEGG   Paenibacillus sp. JDR-2: Pjdr2_4992Help
Entry
Pjdr2_4992        CDS       T00977                                 

Definition
(GenBank) cell envelope-related transcriptional attenuator
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr DUF3887
Motif
Other DBs
NCBI-ProteinID: ACT03603
UniProt: C6D0K4
Position
complement(5707410..5708369)
Genome map
AA seq 319 aa AA seqDB search
MKRGWRRALIGIGAGLVIIAAGTGGYAWHLYGSVKETADKIYEPIQPTVYVSKDPEVTVK
PQQAAQALIEKRHPFTVVVMGVDERENDKGRSDTLIVLAVNPEKKSILMFNIPRDTRTEI
IGHGTTDKINHAYAFGGVSMAKNTVEHFLDYPIDYYIRINMEGFAHLIDILGGVEVNNPF
AFYYEDHQFDKGTLNLNGELALKYSRMRYDDPRGDLGRNARQREIMMEVMKSSLQFSNIT
QIQKILKELGSSVKTNITFDEMKTFMTDYREDLGNINTVEISGSGSMINKVWYLIVSKQE
KERIHELLKEQMDTNQTAS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggggctggagaagagcactcattggcattggagcgggattggtcatcattgct
gccgggacaggcggatatgcctggcacctgtacggttcggtgaaagagacggcggacaaa
atctatgagccgattcagccaacggtatatgtaagcaaggatcctgaggttacggtcaaa
ccgcagcaggcggctcaagctttaatcgagaagcggcatccttttacggtagtagtgatg
ggcgttgatgagcgggaaaatgataaaggacgctccgatactttaattgtgcttgcggtt
aatccagagaagaaatccatcctcatgttcaacattccgcgtgatacgagaaccgaaatt
atcggtcatggaacaacggataaaatcaatcatgcgtatgcctttggcggagtatcgatg
gcgaaaaatacggtcgagcatttcctcgattatcccattgattattacatccggattaac
atggagggcttcgcccatttgattgacatcctcggcggtgtcgaagtaaacaatccgttt
gccttttattacgaggatcatcagtttgataaaggaacacttaatcttaacggcgagctg
gcgctcaaatattccagaatgcgttacgatgatccaagaggggatctcggccggaatgcc
agacagcgggagatcatgatggaggttatgaaaagctcgcttcaattctccaatattacg
cagattcaaaagatattgaaggagcttggaagcagcgtcaaaacaaatattacgtttgac
gagatgaagacctttatgaccgattaccgggaagatctcggcaatattaatacggtggag
attagcggttcggggagcatgatcaataaagtatggtacctgattgtaagcaagcaagag
aaagagagaattcacgagctgcttaaggaacagatggataccaatcagacggcgtcttaa

DBGET integrated database retrieval system