KEGG   Paenibacillus sp. JDR-2: Pjdr2_4996Help
Entry
Pjdr2_4996        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_37 HTH_23 Sigma70_r4 HTH_25 DUF1160
Motif
Other DBs
NCBI-ProteinID: ACT03607
UniProt: C6D0K8
Position
5711036..5711404
Genome map
AA seq 122 aa AA seqDB search
MNIGNRIAGLREERKWTQEQTASKLGISRAALSHYEKNRREPDTETLAKFADLYQVTIDY
LVGRTTNTQAALSEDVRNFVDHLELSDEELLEKYNLSVDGRKLTAEETKRFIAFVRAERM
MN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggaaaccgaattgctggcttgagggaagaaagaaaatggacacaggagcaa
accgcctcgaagctcggcatatcaagagctgcattatctcattacgagaaaaaccgcaga
gagcctgatacggagaccttggcgaagtttgctgacctgtatcaagttaccatagattat
ttggtaggaagaacaacgaatacacaggcggcgttaagcgaagatgttcgtaactttgtc
gatcatttggagctgtctgacgaagagctgctggagaagtataatttaagcgtggacggc
cgtaagcttacagccgaagaaacgaaacggtttattgcctttgttcgggcagaacgtatg
atgaattag

DBGET integrated database retrieval system