KEGG   Paenibacillus sp. JDR-2: Pjdr2_4997Help
Entry
Pjdr2_4997        CDS       T00977                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2975 DUF4271 DUF2070
Motif
Other DBs
NCBI-ProteinID: ACT03608
UniProt: C6D0K9
Position
complement(5711898..5712371)
Genome map
AA seq 157 aa AA seqDB search
MNRVSTLFLKITVLLMAIPAIAVCIFAVIALIRNNPNQFPGRMHPSDIGFFVAVIPYFIA
LYMAMRLLGYIDKNIAFSELSVRALKKIKYCGVSIGIIFVAMMPVVIIMARQEDAPGIIV
MGLAVAFASFVIAVFGALLERLLQNAIKLKSENELTV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagtatccacactttttctaaagataaccgtcttattaatggcgatacctgcg
attgctgtttgcatatttgcggtgatagctttgatacggaataaccctaaccaatttcca
ggcaggatgcatccatcggatatcggcttttttgttgccgtaatcccatactttatagct
ttatatatggccatgagattgcttggttatattgataagaacatcgcgttttccgagttg
tccgtccgggcgttaaagaagattaaatattgcggtgtatctatcggaatcatttttgtg
gcgatgatgccggtcgtaattataatggcgagacaagaagatgcgccggggattatcgta
atggggttggctgtagcttttgcttcatttgtaatcgccgtgtttggcgctttgctcgag
cgtctgctgcaaaacgccataaagcttaagtcagagaatgaacttaccgtttaa

DBGET integrated database retrieval system