KEGG   Paenibacillus sp. JDR-2: Pjdr2_4998Help
Entry
Pjdr2_4998        CDS       T00977                                 

Definition
(GenBank) Glutamate synthase (ferredoxin)
  KO
K00284  glutamate synthase (ferredoxin) [EC:1.4.7.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00630  Glyoxylate and dicarboxylate metabolism
pjd00910  Nitrogen metabolism
pjd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pjdr2_4998
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Pjdr2_4998
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.7  With an iron-sulfur protein as acceptor
    1.4.7.1  glutamate synthase (ferredoxin)
     Pjdr2_4998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG GATase_6 Tti2
Motif
Other DBs
NCBI-ProteinID: ACT03609
UniProt: C6D0L0
Position
complement(5712813..5717414)
Genome map
AA seq 1533 aa AA seqDB search
MKEKIFGLPPKQGLYDPRYEKDACGMGFVANIKGRKSHTVIRQALTLLENMEHRGGQGSE
PNTGDGAGILIQIPHDFFARELKKIEIDLPQEGEYAVGLLFMPHDEAIRSSFERELESII
REEGQSLIGWRTVPTNDSKLGQSALSVKPFVRQVFIAKNPGIQDELSFERKLYVIRKRAE
IAIRFGGKEGGEMFYFTSLSSKKIVYKGMLTTEQVRSFYQELNDEAVVSAMALVHSRFST
NTFPSWERAHPFHYLIHNGEINTLRGNINWMHARQTLFETELFGEDMEKVKPVISPDGSD
TAMFDNALEFLHLSGRSLPHVAMMMVPEPWSNHESMDDKKKAFYEYHSTLMEPWDGPAAM
AITNGTQICAYLDRNGLRPARYYVTKDDHIILGSEAGTVEIAPEEIAYKDRLRPGRMLVV
DTKEGRIISDEEVKAQIAAEQPYREWLDEHLVDLEALPDAPELPELDHATVQQRQQAFGY
TFEDVRKVLEPMASSGQEPIASMGYDAPLAVLSERPQRLFNYFKQLFAQVTNPPIDAIRE
EIVTSVSTTIGPERNLLKPEPESARHIKLDTPILSNEEFAKLRHVRRPGFKSITLPIFFP
AAEGEEGLRAALKLMCDAADRVIDKGHNILILSDRGIDKDNAAIPSLLAVAALHHHLIRQ
GTRTKVAILLESGDPREVHHFALLLGYGVNAVNPYLAFETLDDMIRQGMLSNIKHEKAVK
NFIKAATKGVVKVLSKMGISTIQSYRGAQIFEALGLQEELINEYFTWTPSRIGGIGLDII
AQEALKPHNKAYADQEGGEKELDSGGDYQWRKDGEDHLFSPQTIHTLQMASRKNDYKLYK
KFSNMVQGEDKKHMMLRSLLRFKDGRQSVPIEEVEPVESIFKRFKTGAMSFGSISKEAHE
SLAIAMNRIGGKSNTGEGGEDPARFIPDANGDSRRSAIKQVASGRFGVTSNYLVNADEIQ
IKMAQGAKPGEGGQLPGRKVYPWVAEVRGSTPGVGLISPPPHHDIYSIEDLAELIHDLKN
ANPRARINVKLVSEVGVGTIAAGVAKARADVIMVSGYDGGTGASPMNSIRHAGLPWELGL
AETHQTLMLNNLRDRVVIETDGKMMNGRDVAIAILLGAEEYGFSTAPLVVLGCVMMRVCQ
LDTCPVGVATQNPELRAKFMGDPSHVVNYLHFIAQELREIMAELGFRTIQEMVGRVDILE
SKNLVDHYKAKGIDLSLLLHTPDVPQDAARHNVQEQNHGLELSLDMQELVPGAQAALESG
ERVRGTFPICNTNRVVGTILGSEVTRRYGAKGLPEDTISYHFVGSAGQSFGAFVPKGITL
SLEGDSNDYVGKGLSGGKIIVAPSPKATFVAEENVIIGNTALYGATDGEAYIRGTAGERF
AVRNSGVKVVVEGVGDHGCEYMTGGRVVVLGGTGRNFAAGMSGGVAYVYDEQGDFFNNCN
IEMVLLERLETEADVAELRGLIERHVEYTSSAVGSRVLNDWEGSLAKFVKIIPKDYKKML
EHIRKAEDAGLTDDKALLAAFEESMKELARTGG
NT seq 4602 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaaatttttggattaccgccgaaacaaggtctatacgacccgcgctatgaa
aaagacgcatgcggcatgggatttgtagcaaacatcaagggaagaaaatcgcatactgtc
attcgtcaggcgctgacattgctcgagaacatggagcatcgcggcggtcaaggcagcgaa
cctaacacgggggatggagcaggtatcctgattcaaatcccgcatgatttcttcgcacgt
gaattgaaaaagattgagattgaccttccgcaagaaggagaatatgccgtcggcctgctg
tttatgccccatgatgaagcaatccgcagctcgttcgagcgcgaactggagagcatcatc
cgcgaagagggccaatcgctgatcggctggcgtactgttcctacgaacgattcgaagctt
ggccaatccgctttgtcggtgaagccgttcgttcgccaagtgtttatcgcgaagaacccg
ggcattcaggacgaattgtcctttgagcgcaagctgtatgtcatccgcaaacgcgctgag
attgcaatccgtttcggcggtaaagaaggcggagaaatgttctatttcacaagcctttcg
agcaagaagatcgtctacaaagggatgttgactaccgagcaggtacgctcgttctaccag
gagctgaacgacgaagctgtcgtgtcggctatggcgcttgttcactcccgtttcagtacg
aacactttcccgagctgggaacgcgcgcatcctttccattatctgatccacaacggcgag
atcaatacgctgcgcggcaacatcaactggatgcatgcccgtcagacattgttcgaaacc
gagctgttcggcgaagacatggagaaggtaaaaccggtcatcagcccggatggttccgat
accgcgatgttcgataacgcgcttgagttcttgcatttgtccggccgttcccttccgcat
gttgcgatgatgatggtaccggagccttggtcgaaccatgagagcatggacgacaagaaa
aaagcattctatgaataccactcaaccctgatggagccatgggacggacctgccgcaatg
gcgattacgaacggtacgcaaatctgcgcttacctggaccgtaacggcctgcgcccagcc
cgttattatgtaacgaaagacgatcatatcatcctcggttccgaagccggcactgtcgaa
atcgctccagaagagattgcgtacaaagaccgtctccgcccgggccgtatgctcgttgta
gatacgaaagaaggccgcattatttccgacgaggaagtaaaagcgcaaatcgcggctgaa
cagccttaccgcgaatggctcgacgagcatctcgttgatctcgaagcattgccggacgcg
ccagagcttcctgagctggatcacgctaccgtgcaacagcgtcagcaggcattcggctat
acgttcgaagacgttcgcaaagtgcttgagccaatggcgagcagcggccaggagccgatc
gcttccatgggttacgacgcgccgcttgccgtattgtccgagcgccctcagcgcctgttc
aactacttcaagcagctgttcgcgcaagttacgaacccgccgatcgacgcaatccgcgaa
gagatcgttacatcggtaagcacgacaatcggacctgagcgcaacctgctgaagcctgaa
ccggaaagcgcgcgccatatcaagctggatacgccaatcctgtcgaacgaggaattcgcg
aagcttcgccacgtacgccgtcccggcttcaagtcgattacgcttccgatcttcttcccg
gccgccgaaggcgaagaaggcctgcgcgcagcgctgaagctgatgtgcgatgcagcggac
cgcgttattgataaaggccataatattcttattttgtccgaccgcggtattgacaaggac
aacgctgcgatcccgtcgctgcttgccgtagcggctttgcaccatcacctgatccgtcaa
ggtacaagaacaaaggtggcgattctgcttgaatccggcgatccgcgcgaagtgcatcat
tttgccctcctgctcggttacggcgttaatgcagttaacccttatctcgcattcgagacg
cttgacgatatgatccgccaaggcatgctcagcaacatcaagcatgagaaggctgttaag
aacttcatcaaagcggcaacaaaaggcgtagtaaaagttctgtccaaaatgggtatttcg
accattcaatcgtaccgcggcgcgcagatcttcgaagcgcttggcctgcaggaagagctg
attaacgaatacttcacatggacgccatcgcgtattggcggtatcggtctcgatatcatc
gcccaagaagcgctgaagcctcataacaaagcttacgctgaccaagagggcggggagaag
gaactcgactccggcggcgattaccaatggcgtaaagacggcgaagaccatttgttcagc
ccgcaaacgattcacacgctgcaaatggcatcccgtaagaacgactataaactgtacaag
aagttctcgaacatggttcaaggcgaagacaagaagcatatgatgctccgctcgctgctc
cggttcaaggatggacgtcaatcggtacctattgaagaggttgaaccggttgaatcgatc
ttcaaacgtttcaaaacaggcgcaatgtcgtttggttccatcagtaaagaagcgcatgag
agcctcgcaatcgcgatgaaccgtattggcggcaaatccaataccggcgagggcggcgaa
gatcctgcgcgctttatccctgacgcaaacggcgattcccgccgcagtgcgatcaagcag
gttgcatcgggccgtttcggcgtaacgagcaactacttggttaacgcggatgagattcaa
atcaagatggcgcaaggcgcgaaaccgggtgaaggcggtcagcttccaggacgcaaggta
tatccttgggttgcggaagttcgcggttccactccgggcgtaggcttgatctcgccgcct
ccgcatcatgatatttattcgatcgaggaccttgccgagctgattcacgacctgaagaac
gcaaaccctcgcgcccgtatcaacgtgaagctcgtatccgaggttggcgtaggcacaatt
gctgcaggtgttgcgaaagctcgtgctgacgttatcatggtcagcggttacgacggcggt
actggcgcatccccgatgaactcgatccgccatgcgggtctgccatgggagcttggcctt
gcggagacgcatcaaacgctgatgctgaacaatctgcgcgaccgcgtcgttatcgaaacc
gatggtaaaatgatgaacggccgcgacgttgcgatcgcaattcttctcggcgctgaagaa
tacggcttctctaccgcaccgctcgttgtactgggctgcgttatgatgcgcgtatgtcag
ctggatacttgcccggttggcgttgcaacgcaaaaccctgagcttcgcgcgaagtttatg
ggcgatccgagccatgtcgtgaactacttgcacttcattgcgcaggagctccgtgaaatt
atggctgagcttggtttccgtaccattcaagaaatggttggccgcgtcgatattcttgaa
tcgaaaaacctggttgatcactataaagcaaaaggtatcgatcttagccttctgctgcat
acgccggatgtaccgcaagacgcagcgcgtcataacgtacaagagcaaaatcacggcctc
gagctgtcgctcgacatgcaggagctcgttccgggtgcgcaagcagctctggaaagcggc
gaacgcgttcgcggcacattcccgatctgcaacacaaaccgcgtagttggtacaattctg
ggcagcgaagtaacccgtcgttacggcgcgaaaggcttgcctgaagatacaatctcgtac
catttcgttggatctgccggccaaagctttggcgcatttgtaccgaagggcattacgctc
tcgctcgaaggcgactccaatgactatgtaggcaaaggcctctctggcggtaaaattatc
gttgctccgtctccgaaagctacatttgtagccgaagagaacgttattatcggcaacacg
gcgctgtacggtgcaacggatggcgaagcttacattcgcggtaccgcaggcgaacgcttc
gcggttcgtaactccggcgtgaaggttgttgttgagggcgtaggcgatcatggttgtgaa
tacatgactggcggccgggttgttgtgcttggcggcacaggccgcaacttcgcggcaggt
atgtccggcggtgttgcttacgtgtacgatgagcaaggtgatttcttcaacaattgcaat
atcgagatggttctccttgagcgtctggagacagaagcggatgttgccgagcttcgcggc
ctgattgagcgccatgtggagtacacaagctctgcggttggctcgcgtgtcctgaacgat
tgggaaggatcgctcgcgaaattcgtgaagattattccgaaggattacaagaaaatgctg
gagcatatccgcaaagcggaagatgcaggcttgacggacgacaaagcacttctcgctgct
ttcgaggaaagcatgaaagagctggctcgtaccggaggataa

DBGET integrated database retrieval system