KEGG   Paenibacillus sp. JDR-2: Pjdr2_5001Help
Entry
Pjdr2_5001        CDS       T00977                                 

Definition
(GenBank) Monogalactosyldiacylglycerol synthase
  KO
K03429  processive 1,2-diacylglycerol beta-glucosyltransferase [EC:2.4.1.315]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00561  Glycerolipid metabolism
pjd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Pjdr2_5001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pjd01003]
    Pjdr2_5001
Enzymes [BR:pjd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.315  diglucosyl diacylglycerol synthase (1,6-linking)
     Pjdr2_5001
Glycosyltransferases [BR:pjd01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   Pjdr2_5001
 Glycan extension
  Glycolipid
   Pjdr2_5001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ACT03612
UniProt: C6D0L3
Position
5719841..5720956
Genome map
AA seq 371 aa AA seqDB search
MRKKRVLLLSEGFGSGHTQAAHALAAGLRQLNPDIQTRVMELGNFLNPVLGPLIISAYRK
TVSKQPKMVGLMYRSNYKKSLNRFMQLALHRMFYTHTSQVIAQLKPDLVICTHPVPNAVV
SRLKRLGLNIKLCTVITDYDAHGSWVNQEVNKFLVSSSLVKDKLINHSVPESRIAVTGIP
VHPLFWKSYDKVQIREQFGLKELPTVLIMGGGWGLMYEDSLLEYMTEWRERVQFIFCVGN
NDKVKEKMLANPRFRHNNVRIIGFTKEVSKLMDVADVLVTKPGGMTCTEGMSKGIPMLFY
EPIPGQEEQNCEYFIKNGFGEMLETTETVDKWMAVIQQPETSARYRQTLINKRNEEYNPL
TCPKAVLQLLQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaaagagtgctcctgctctccgaaggattcggatcagggcacacgcaagcc
gcgcatgctttggcagcaggcctgcgccagctcaacccggatatacagacccgcgtgatg
gagctgggcaattttcttaatcccgtgctaggacctttaattatttccgcctatcgcaaa
acggtcagcaagcagcccaagatggttggcctgatgtaccgcagcaattataaaaaatcg
ctaaaccgatttatgcagcttgcgcttcaccgtatgttttatacacatacttcgcaagtc
atcgcccaattgaagccggatctcgttatttgtactcatcctgttccgaatgcggttgtc
agccgcctgaagcggcttgggctgaacataaagctatgtaccgtcattaccgattacgat
gcgcacggttcatgggtgaaccaggaagtgaacaagttccttgtctcctcttccctggtg
aaggacaagctcattaaccacagcgtgccggagagccggattgcggtaaccggcatcccc
gttcatcctcttttctggaaatcctacgataaggtccagatcagggaacagtttggactt
aaggagcttcctaccgtccttattatgggcggcggctggggtcttatgtatgaagacagc
ctgctggaatatatgacggagtggcgcgaacgcgttcaatttattttttgcgtaggcaat
aatgacaaggtgaaagaaaaaatgcttgcgaatccgagattccggcataataacgtccgg
attatcggatttaccaaagaagtcagcaagctgatggatgtggcggatgttcttgtaacc
aagccaggcgggatgacctgcacggaagggatgagcaaaggcattccgatgctgttctac
gagccgattcccgggcaggaagaacaaaactgcgaatatttcatcaaaaacggctttggc
gaaatgctggagacgaccgaaacggttgataaatggatggctgtcattcagcagcccgag
acatcagcccgataccgccagaccctgatcaataaaagaaacgaagaatataatcccctt
acttgtcctaaagccgtcttgcagctgttgcaatga

DBGET integrated database retrieval system