KEGG   Paenibacillus sp. JDR-2: Pjdr2_5005Help
Entry
Pjdr2_5005        CDS       T00977                                 

Definition
(GenBank) acyltransferase 3
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 CBP_BcsF
Motif
Other DBs
NCBI-ProteinID: ACT03616
UniProt: C6D0L7
Position
5724880..5726070
Genome map
AA seq 396 aa AA seqDB search
MNTTSLALQKRDKIPELSLVRAMAITGVLSVHSTSFATIAMINSKYFFLYNFFNIFMKIG
TTTFIFLSSFVLFYNYYSRPLDKQLLGSFYKKRLLYIIIPYLVFSLFYFTILHFLYYPDR
SLSNEIHRFIEKVLTGSAYTHLYFVFINIQFYLMFPLFLWLLKKYPRMVKWAIPAGFALQ
WGFFLLNKYGLPAPVPNRGSWSFSYFSYYLLGAALGIYYPKVKEWIIAAKENATAVRVTA
WVILWACWIVAGLTHVYLYHETRLQKQSFNSTLFDLVWNIHGILTALVLLQLAFILTRKL
PKAINRLIARLGSLSFGIYLIHPFFLLVYREFPPHAEAWMLHLWYLGGFALALAGSWFVV
GFFARYVPFNWIAFGNLPKKQQQSFKPVRPERQLKA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacctcactagccttgcagaaaagagacaagattcctgaactatccctcgta
agggcgatggccatcacaggtgtcctgtccgttcactctacttcatttgctactattgct
atgataaattcgaaatacttctttctttataatttcttcaatatttttatgaaaatcggt
acaacaacgtttattttcttaagcagctttgtccttttttacaactattattcccgtcca
ttggacaagcagctgctggggagcttctacaagaaacggctcctgtatattattattcct
tatcttgtattttcattgttttactttacgattttgcatttcttatattacccggaccgc
tcgctgtcaaatgagattcatcgtttcattgagaaagtactaaccggcagtgcctacacg
catctttattttgtgtttatcaacattcagttttatctcatgttcccgctttttttatgg
ctgttaaaaaagtatccgcgtatggtcaaatgggcgattcctgcaggctttgccctccaa
tggggatttttcctgcttaacaaatacggacttccggcacccgtccctaaccgcggaagc
tggtcgttctcctacttctcgtattatctgcttggcgctgctctaggcatctactatccg
aaggtgaaagaatggataatcgccgctaaagaaaatgccactgccgtccgcgttacggca
tgggtcatcttatgggcttgctggatcgttgccggcttaacccacgtgtatttgtaccat
gaaacgagacttcaaaagcaatccttcaattcaacgttgtttgatctggtgtggaatatt
catggcatactaaccgctctcgtcctcctgcaattggcctttatcctgaccaggaagctg
ccgaaggctataaacagactgatcgcaagacttggctccttgtcttttggcatatacctg
atccatcctttcttcctgctcgtctaccgggaattcccgcctcacgcggaagcttggatg
cttcatctatggtatctcggcggattcgcactcgctcttgctggatcatggtttgtagtt
ggtttcttcgcccgttacgtgccctttaactggatagccttcggtaacctcccaaagaag
caacaacagtctttcaagccggttcgcccggaaagacaactgaaggcgtaa

DBGET integrated database retrieval system