KEGG   Paenibacillus sp. JDR-2: Pjdr2_5011Help
Entry
Pjdr2_5011        CDS       T00977                                 

Definition
(GenBank) transglutaminase domain protein
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core DUF553
Motif
Other DBs
NCBI-ProteinID: ACT03622
UniProt: C6D0M3
Position
complement(5732770..5733912)
Genome map
AA seq 380 aa AA seqDB search
MRKTGWKIATVAALLAVAIGLNMKSDLFSVFASASSGGGGTIDQLEDELASQFQSRSEHF
TLQYKGDKHKLSDGLQNTINLALAQDDYTAYILDSYLYTIRSWGNLSTIKLEARYRETTD
QTAAVDAMVSKAIKQIITPQMNEHEKVKAIHDWIVNRLQYDETLKHYTAYDALTTGTAVC
QGYSLLAYKMLKAVGIPVLIAEGKVKTGDHAWNMVQLGGNWYHLDMTWDDPVVKQAGTQQ
TESRLSYNYYLKTDDEMRVDHQWIKTYPTANHSYGSELSKLKSTDSGKADVYAKLITDLG
LHWTEPENTVASLVELEQEIREAVMEQQTGMKFRYLQGSQLATDLPTAFKVAHVSVRYSA
RYEPYGNDGSMLVQVQLDYQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaacaggttggaaaatagcgacagtagcggccttgcttgccgttgccattggt
ttaaatatgaaatccgatctgttctctgtttttgcgtctgcgtcaagcggcggaggcggt
acgatcgatcagcttgaggatgagctggcatcgcaatttcaaagcagatccgagcatttt
acgcttcaatataaaggagacaagcacaagctttccgacggcttgcaaaatacgattaat
ctggcgcttgcgcaggatgattacaccgcgtatatccttgactcctatctttatacaatc
cgcagctggggtaatctgtccaccataaagctggaggccagataccgcgaaacgacggac
cagaccgctgccgttgatgcaatggtgagcaaagcgatcaagcagattattaccccgcag
atgaatgagcatgagaaggtgaaggcgatccacgactggattgttaatagacttcagtat
gacgagaccctaaagcattacaccgcttacgatgctctcacaacgggaaccgctgtatgt
caaggttattcgctacttgcttataaaatgctaaaagctgtcggaattcctgttcttatt
gccgagggcaaagttaagaccggcgaccatgcctggaatatggtgcagctcggcggcaat
tggtatcatctcgatatgacctgggatgatcccgttgtgaagcaagccggcacgcagcag
accgagtcccgtctcagctataattattatttgaagacggatgacgagatgcgcgtcgat
catcaatggatcaaaacctatccaacggcgaaccattcctacggcagcgagctcagcaag
ctgaagagcacggacagcgggaaggcggatgtttacgctaagctcatcaccgatcttggc
ctgcattggacggagccggaaaatacggtagcaagcctggtagagctggagcaggagatc
cgcgaggctgtaatggagcagcagacgggcatgaagttccgttatctgcaaggttcgcag
cttgcgaccgatctgccgacggcctttaaggtagcgcatgtatccgttcgctattcggct
cgttacgagccatacggcaatgacggttcgatgcttgtgcaggttcagctggattatcaa
taa

DBGET integrated database retrieval system