KEGG   Paenibacillus sp. JDR-2: Pjdr2_5014Help
Entry
Pjdr2_5014        CDS       T00977                                 

Definition
(GenBank) glycoside hydrolase family 43
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_43 Glyco_hydro_32N Glyco_hydro_130
Motif
Other DBs
NCBI-ProteinID: ACT03625
UniProt: C6D0M6
Position
complement(5738176..5740599)
Genome map
AA seq 807 aa AA seqDB search
MSGWQMKRSLIGIGIAVVLATGGGGIWLLTQKQDEQEQSREAITMDRTYRNPMTLDQEWE
DYGIGDPYVLRYNGKYYLYCSTKDWRVGIKAWSSDDLVNWSYEGLVTEEPVSEGAYAPEV
VYWNGSFYMYTSPAGKGHYVLQSDSPTGPFKVKTDNLGLTIDGSVFIDDDAKWYFTHAES
GGIMASSMIDPYTIEAGDKLNTSLGHWTEGSMIIKRGGRYFITYTGNHVFSKGYRVNYAV
GHESPTGLYTIPDNNPIIISTDKDFNGLGHSATVLGPDMDSYYIVYHNLVGSSAEGPPVR
KLNMDRLTFNGDKMSVLGPTHDAPVPAPALPAFRDPLGGSPSADKWQSPEISGTDAAWVA
TKPTGDRFTAEYNVILGSESGELETIFSYTSADDYRSIRINPAEHSISLRDAAADKEVQK
ASLPEGMDFSKLHAVRVEADQSGTRVYWDGLLLIDNAEFTAKAGQIGYAWTGGLKPELQY
TAFSNEAGGSSDNKMIKQVPGTMEAVHAAASGNNEVTIHHEGTPDGSYSAELTGKASELA
FPVYVHSDGDYMLAAMVSDASAGSTLEVEAGGVKRSVKLKAEEFVTEDDSSEWMKVPLGT
YPLKQGLQWLTLSRGKGNPDIRFIETIEAAAPEGEQQVAFDPDSTFGYWQEESGTVGLQL
AGDNSMIFGGDTRWTDMEVGVEITQAEAAEDEASILLRTTMESSFRDQVADSFIGYELTF
RNGRIILKKVSYEVNQELTSGVLELGSGKAHPIRIKLKGPSIQVFDGDNDEPVLTWTDRN
AFLHGRIGLRASSSDWQFGNITVNTKS
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatggcaaatgaaacgatccttgatcggcattggcatcgcggtcgtactcgca
acaggcgggggagggatttggttgcttacgcaaaagcaggatgagcaggaacaatcaaga
gaggctattacgatggaccggacctatcggaatccgatgacgctcgaccaggaatgggag
gattacggcatcggcgatccttacgtgctgcgctacaacggcaaatattatttgtactgc
agcacgaaggactggcgggtcggcataaaagcatggagctccgacgatctggtgaattgg
agctacgaagggctggtaacggaggagccggtaagcgaaggcgcttatgcgccggaagtg
gtgtattggaacggttccttctatatgtacacatctccagcgggtaaagggcattatgtg
ctgcaaagcgacagtcccacagggccgttcaaggtgaaaaccgataatctgggcctcacg
attgatggctccgtctttatcgacgatgatgccaaatggtatttcacccatgcggaatcc
ggcggcattatggccagcagcatgattgatccttatacgatcgaagcaggcgataagctg
aacacgtcattggggcattggacggaaggctcaatgattattaagcggggcggcagatat
ttcataacgtataccggcaatcacgtgttctccaagggctatcgcgttaattacgcggta
gggcatgagtcgccaaccggcctgtatacgattcctgacaataatccgattatcatctcg
acggacaaagattttaacggactggggcatagcgcaacggtgcttggtccggacatggac
tcctattatatcgtttatcacaatctggtcggcagttcggccgaaggacctccggtaagg
aagcttaatatggaccgtctaacgtttaacggggacaaaatgtccgtgcttggcccaacg
catgatgcgccggtaccggctcccgcgcttccggcgttccgcgatccgcttggcggcagt
ccaagcgcggataaatggcaatcgcctgaaatctccggtactgatgcagcttgggtcgca
acgaagccaacgggggaccgttttacggcggaatacaacgttatcttaggcagcgaaagc
ggtgaactggagaccatcttctcttatacaagcgcggatgattatcgcagcattcggatc
aatccggcggagcattccatttcgttaagggatgcggctgcggataaagaagtgcagaag
gcctctttacctgaagggatggatttctccaagctgcatgccgtgcgggtggaagcggat
cagagcggaacaagagtgtattgggatggactgctgctcatcgataacgcggagtttacg
gcaaaagccggtcaaatcggttacgcctggacgggcggcttgaagccggagctgcagtat
acggcattctcgaatgaagcgggcggcagcagcgacaacaaaatgatcaagcaggtgccc
ggcacgatggaggccgtacacgccgcagcgtccggcaataacgaagtcactattcatcat
gaaggaacacctgatggaagctactcggccgagttaaccggcaaagcttcggagcttgct
ttcccggtatacgtccattcggatggggattatatgctggctgcgatggtatcggatgct
tcggcgggttctacgcttgaggttgaagcgggcggcgtaaagcggtccgtaaagcttaag
gcggaagagttcgtaaccgaggacgattcctcggaatggatgaaggttccgctcggaacg
tatccgttgaagcagggcttgcagtggctgacgctttccagaggaaaaggaaatccggac
atccggttcatcgaaacaatcgaggcggcagcgcctgaaggagagcagcaggttgctttt
gaccctgactcgacctttggttattggcaggaagagagcggtaccgtaggcctgcagctg
gccggcgataattccatgatttttggcggggatacccgctggacggatatggaggttggc
gtggaaataacgcaggcagaagccgcggaagacgaggcgtctattctgctgcggacaacc
atggaatcatcctttcgcgatcaggttgctgattcttttatcgggtatgagcttaccttc
cgcaatggcagaatcatcctgaagaaagtcagctacgaagtgaatcaggagcttacctcc
ggcgtgctggagctggggagcggcaaagcccatccgattcggatcaagctgaaggggcca
agcatccaggtatttgacggggacaatgacgagcccgttctgacctggacggaccggaat
gccttcctgcatggacggatcggacttcgcgcgagctcttcggactggcaattcggcaat
atcacggtaaatacgaaatcataa

DBGET integrated database retrieval system