KEGG   Paenibacillus sp. JDR-2: Pjdr2_5015Help
Entry
Pjdr2_5015        CDS       T00977                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02026  multiple sugar transport system permease protein
Organism
pjd  Paenibacillus sp. JDR-2
Module
pjd_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:pjd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pjd02000]
    Pjdr2_5015
Transporters [BR:pjd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Pjdr2_5015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACT03626
UniProt: C6D0M7
Position
complement(5740604..5741443)
Genome map
AA seq 279 aa AA seqDB search
MANQRRLINTVLFVLLLAGSVIMLGPLVWTVSTSLKTQQHVFDVPPQWIPEPLTWLNYKD
VWSKAPLLYGFMNSAIVVVCVLTVGLFVAAMAAYAFSKFEFPFKEWIFMALLGTMMIPYS
VVMIPQYIGFSELGWVDTLAPLIVPGLFGNIVTIFFFRQFMQGSIPNDLIDAAKIDGCGY
FRTFTTVALPIAKPAIAAQAALGFMGIWNDFMGPLIYLHTPERQTIQVLIASMQSNYIST
SNYPSLMAASIVALVPVVIVFFMAQRYFIESMAISGIKG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcaacgccgtcttatcaataccgttttattcgtgctgctgcttgcgggatcc
gttattatgctgggcccgctcgtatggacagtgtcgacttcgttaaaaacgcagcagcat
gtgttcgatgtgcctccgcaatggattcccgaaccgctcacttggctcaactataaggat
gtctggtcgaaggcgcctttattatacggattcatgaacagcgcaatcgttgtagtgtgc
gtgctgaccgtaggtttgtttgtggcggcaatggccgcttatgcgttctccaagttcgag
tttccgttcaaggaatggatctttatggcgctgcttggcaccatgatgattccttattcg
gtcgtgatgattccgcaatatatcggcttctcggaacttgggtgggtggatacgcttgcg
ccgcttatcgttccgggcctattcggcaatatcgtaacgatcttcttcttccgtcagttt
atgcagggctctattccgaatgatctgatcgatgcggccaaaatcgacggatgcggctat
ttccgcacctttacgaccgttgcgcttccgattgcgaagccggcgattgccgcacaagca
gcgcttggttttatgggcatctggaatgattttatgggtccgctgatttacctgcatacg
cctgaacgccaaacgattcaagtgcttatcgcaagcatgcagtccaactatatttccact
tcgaattacccgtctctgatggcggcgtcgattgttgcgcttgtgccggttgttatcgtg
ttctttatggcacagcgttacttcattgaatcgatggcaatcagcggtattaaggggtaa

DBGET integrated database retrieval system