KEGG   Paenibacillus sp. JDR-2: Pjdr2_5019Help
Entry
Pjdr2_5019        CDS       T00977                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
pjd  Paenibacillus sp. JDR-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: ACT03630
UniProt: C6D0N1
Position
complement(5745185..5746057)
Genome map
AA seq 290 aa AA seqDB search
MNIEKYRIFSKVVEVGGLTKAGELLNLTQSAISHAVSSLENELGLSLLIRNRAGIQLTNN
GESLIHPIREILRANDILNQEVAAIKGIEIGAIKIATFTSVSIQWLPQILKQFQNLYPQI
DVKLLDGNYHEIEEWIANGSADFGFVNLPTREAFDVVPLHRDRMMCVMNAGHPFSHRRAI
SLELIIEEPFIMPVAGCDTDVQRIFSQNECKPRIKYELEDDHAIIAMVQSNLGISILPEM
ILSHLPDNVCCRPLDSEHYRNIGLAARSFKNVSPAAKKLIEWIRTWITSR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaaaaataccggatttttagcaaggtcgttgaggtgggaggtttaacaaag
gcaggggagctcttgaatctgacgcaatctgcgatcagtcacgcggtttccagcttggag
aacgagcttggcttgagcttgcttataagaaacagggccggaattcagcttacgaacaac
ggtgaaagtctgattcatcctatcagagaaattcttcgcgcgaatgatattttgaatcaa
gaggtagccgctattaaaggaatcgaaatcggagccattaagatcgcgaccttcactagc
gtttcgatacaatggctgccgcaaatcttgaagcaatttcagaatctatatcctcaaatt
gatgtgaagctactggacggcaactatcatgagatcgaggagtggatcgcgaatggatcg
gccgattttggctttgttaatttgcctacccgcgaagcctttgatgtagtgccgcttcat
cgggataggatgatgtgcgtaatgaatgccgggcatcctttcagtcatcggagggcgatc
agcttggaactaattatcgaggagccttttattatgccggttgcaggatgtgacacggat
gtgcaacgaatcttctcgcaaaacgaatgcaagccgcggattaaatacgagttggaggat
gaccatgccattattgcaatggtgcaaagcaatttggggatcagcattcttcccgaaatg
atattgtcgcatcttccggacaatgtgtgctgccgcccgctggacagcgagcattaccgc
aatattggccttgccgcaagatcttttaaaaatgtctccccggctgccaaaaagctgatt
gaatggattagaacttggatcacttcccgataa

DBGET integrated database retrieval system